Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LEFTY1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Rabbit anti-Human LEFTY1 Polyclonal Antibody | anti-LEFTY1 antibody

LEFTY1 antibody - N-terminal region

Gene Names
LEFTY1; LEFTB; LEFTYB
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LEFTY1; Polyclonal Antibody; LEFTY1 antibody - N-terminal region; anti-LEFTY1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
Sequence Length
366
Applicable Applications for anti-LEFTY1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LEFTY1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-LEFTY1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Transfected 293T)
Related Product Information for anti-LEFTY1 antibody
This is a rabbit polyclonal antibody against LEFTY1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LEFTY1 is a member of the TGF-beta family of proteins. A similar secreted protein in mouse plays a role in left-right asymmetry determination of organ systems during development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
left-right determination factor 1 preproprotein
NCBI Official Synonym Full Names
left-right determination factor 1
NCBI Official Symbol
LEFTY1
NCBI Official Synonym Symbols
LEFTB; LEFTYB
NCBI Protein Information
left-right determination factor 1
UniProt Protein Name
Left-right determination factor 1
UniProt Gene Name
LEFTY1
UniProt Synonym Gene Names
LEFTB; LEFTYB
UniProt Entry Name
LFTY1_HUMAN

NCBI Description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. [provided by RefSeq, Aug 2016]

Research Articles on LEFTY1

Similar Products

Product Notes

The LEFTY1 lefty1 (Catalog #AAA3210763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LEFTY1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LEFTY1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LEFTY1 lefty1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQPLWLCWAL WVLPLASPGA ALTGEQLLGS LLRQLQLKEV PTLDRADMEE. It is sometimes possible for the material contained within the vial of "LEFTY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.