Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADDB antibody Titration: 1 ug/mLSample Type: Human U937 Whole Cell)

Rabbit anti-Human ADD2 Polyclonal Antibody | anti-ADD2 antibody

ADD2 Antibody - C-terminal region

Gene Names
ADD2; ADDB
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADD2; Polyclonal Antibody; ADD2 Antibody - C-terminal region; anti-ADD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT
Sequence Length
726
Applicable Applications for anti-ADD2 antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADDB antibody Titration: 1 ug/mLSample Type: Human U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-ADDB antibody Titration: 1 ug/mLSample Type: Human U937 Whole Cell)
Related Product Information for anti-ADD2 antibody
This is a rabbit polyclonal antibody against ADDB. It was validated on Western Blot

Target Description: Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
119
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79 kDa
NCBI Official Full Name
beta-adducin isoform a
NCBI Official Synonym Full Names
adducin 2
NCBI Official Symbol
ADD2
NCBI Official Synonym Symbols
ADDB
NCBI Protein Information
beta-adducin
UniProt Protein Name
Beta-adducin
UniProt Gene Name
ADD2
UniProt Synonym Gene Names
ADDB
UniProt Entry Name
ADDB_HUMAN

NCBI Description

Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jun 2010]

Uniprot Description

ADD2: a cytoskeletal protein that promotes the assembly of the spectrin-actin network. Adducin is a heterodimeric protein that consists of related subunits. Alpha- and beta-adducin include a protease-resistant N-terminal region and a protease-sensitive, hydrophilic C-terminal region. Adducin binds with high affinity to Ca(2+)/calmodulin and is a substrate for protein kinases A and C. Beta-adducin is restricted to brain and hematopoietic tissues. Three alternatively-spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: F-actin capping protein complex; cytoplasmic membrane-bound vesicle; plasma membrane

Molecular Function: actin filament binding; calmodulin binding; protein homodimerization activity; spectrin binding; protein heterodimerization activity; actin binding; structural molecule activity

Biological Process: actin filament bundle formation; positive regulation of protein binding; hemopoiesis; protein complex assembly; barbed-end actin filament capping; actin cytoskeleton organization and biogenesis

Research Articles on ADD2

Similar Products

Product Notes

The ADD2 add2 (Catalog #AAA3210754) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADD2 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADD2 add2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAGPQSQLLA SVIAEKSRSP STESQLMSKG DEDTKDDSEE TVPNPFSQLT. It is sometimes possible for the material contained within the vial of "ADD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.