Western Blot (WB)
(WB Suggested Anti-Fzr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Rabbit Fzr1 Polyclonal Antibody | anti-FZR1 antibody
Fzr1 antibody - N-terminal region
Gene Names
Fzr1; FZR; Fyr; Cdh1; FZR2; HCDH; HCDH1; AW108046
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fzr1; Polyclonal Antibody; Fzr1 antibody - N-terminal region; anti-FZR1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN
Sequence Length
493
Applicable Applications for anti-FZR1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Fzr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Fzr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Heart)
Related Product Information for anti-FZR1 antibody
This is a rabbit polyclonal antibody against Fzr1. It was validated on Western Blot
Target Description: Fzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Target Description: Fzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
Product Categories/Family for anti-FZR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
fizzy-related protein homolog
NCBI Official Synonym Full Names
fizzy and cell division cycle 20 related 1
NCBI Official Symbol
Fzr1
NCBI Official Synonym Symbols
FZR; Fyr; Cdh1; FZR2; HCDH; HCDH1; AW108046
NCBI Protein Information
fizzy-related protein homolog
UniProt Protein Name
Fizzy-related protein homolog
Protein Family
UniProt Gene Name
Fzr1
UniProt Synonym Gene Names
Fyr; Fzr; Fzr
UniProt Entry Name
FZR_MOUSE
Research Articles on FZR1
Similar Products
Product Notes
The FZR1 fzr1 (Catalog #AAA3210286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fzr1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Fzr1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FZR1 fzr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQIIIQNENT VPCVSEMRRT LTPANSPVSS PSKHGDRFIP SRAGANWSVN. It is sometimes possible for the material contained within the vial of "Fzr1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
