Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CACYBP Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Rabbit CACYBP Polyclonal Antibody | anti-CACYBP antibody

CACYBP antibody - middle region

Gene Names
CACYBP; SIP; GIG5; PNAS-107; S100A6BP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CACYBP; Polyclonal Antibody; CACYBP antibody - middle region; anti-CACYBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKK
Sequence Length
228
Applicable Applications for anti-CACYBP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CACYBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CACYBP Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-CACYBP Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-CACYBP antibody
This is a rabbit polyclonal antibody against CACYBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CACYBP is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin.The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
calcyclin-binding protein isoform 1
NCBI Official Synonym Full Names
calcyclin binding protein
NCBI Official Symbol
CACYBP
NCBI Official Synonym Symbols
SIP; GIG5; PNAS-107; S100A6BP
NCBI Protein Information
calcyclin-binding protein
UniProt Protein Name
Calcyclin-binding protein
Protein Family
UniProt Gene Name
CACYBP
UniProt Synonym Gene Names
S100A6BP; SIP; CacyBP; hCacyBP
UniProt Entry Name
CYBP_HUMAN

NCBI Description

The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CACYBP: a nuclear/cytoplasmic protein involved in calcium-dependent ubiquitination and proteosomal degradation of target proteins. A possible molecular bridge in ubiquitin E3 complexes. Participates in the ubiquitin-mediated degradation of beta-catenin (CTNNB1). Interacts with proteins of the S100 family at physiological calcium concentrations. Component of some large E3 complexes and interacts directly with SIAH1, SIAH2 and SKP1A. Cytoplasmic at low calcium concentrations. In neuroblastoma cells, after a retinoic acid (RA) induction and calcium increase, it localizes in both the nucleus and cytoplasm. The nuclear fraction may be phosphorylated. Two alternatively spliced isoforms have been described.

Protein type: Ubiquitin conjugating system; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q24-q25

Cellular Component: nucleoplasm; neuron projection; nuclear envelope lumen; cytoplasm; beta-catenin destruction complex

Molecular Function: protein binding; protein homodimerization activity

Biological Process: positive regulation of DNA replication; cardiac muscle cell differentiation; aging

Research Articles on CACYBP

Similar Products

Product Notes

The CACYBP cacybp (Catalog #AAA3210275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CACYBP antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CACYBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CACYBP cacybp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTERSFDLLV KNLNGKSYSM IVNNLLKPIS VEGSSKKVKT DTVLILCRKK. It is sometimes possible for the material contained within the vial of "CACYBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.