Western Blot (WB)
(WB Suggested Anti-SCRT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Rabbit SCRT2 Polyclonal Antibody | anti-SCRT2 antibody
SCRT2 antibody - middle region
Gene Names
SCRT2; ZNF898B
Reactivity
Dog, Guinea Pig, Human, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SCRT2; Polyclonal Antibody; SCRT2 antibody - middle region; anti-SCRT2 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS
Sequence Length
307
Applicable Applications for anti-SCRT2 antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 79%; Human: 100%; Rat: 85%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SCRT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SCRT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-SCRT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)
Related Product Information for anti-SCRT2 antibody
This is a rabbit polyclonal antibody against SCRT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
Target Description: SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.
Product Categories/Family for anti-SCRT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
transcriptional repressor scratch 2
NCBI Official Synonym Full Names
scratch family transcriptional repressor 2
NCBI Official Symbol
SCRT2
NCBI Official Synonym Symbols
ZNF898B
NCBI Protein Information
transcriptional repressor scratch 2
UniProt Protein Name
Transcriptional repressor scratch 2
Protein Family
UniProt Gene Name
SCRT2
UniProt Synonym Gene Names
FP7030
UniProt Entry Name
SCRT2_HUMAN
Research Articles on SCRT2
Similar Products
Product Notes
The SCRT2 scrt2 (Catalog #AAA3210073) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCRT2 antibody - middle region reacts with Dog, Guinea Pig, Human, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SCRT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SCRT2 scrt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HMQTHSAFKH YRCRQCDKSF ALKSYLHKHC EAACAKAAEP PPPTPAGPAS. It is sometimes possible for the material contained within the vial of "SCRT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
