Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Testis)

Rabbit MED4 Polyclonal Antibody | anti-MED4 antibody

MED4 antibody - C-terminal region

Gene Names
MED4; ARC36; VDRIP; DRIP36; TRAP36; HSPC126
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MED4; Polyclonal Antibody; MED4 antibody - C-terminal region; anti-MED4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSS
Sequence Length
270
Applicable Applications for anti-MED4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MED4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Testis)

Immunohistochemistry (IHC) (Human Testis)

Immunohistochemistry (IHC)

(Human Testis)

Immunohistochemistry (IHC) (Human Testis)

Western Blot (WB)

(WB Suggested Anti-MED4 Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MED4 Antibody Titration: 0.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-MED4 antibody
This is a rabbit polyclonal antibody against MED4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
mediator of RNA polymerase II transcription subunit 4 isoform 1
NCBI Official Synonym Full Names
mediator complex subunit 4
NCBI Official Symbol
MED4
NCBI Official Synonym Symbols
ARC36; VDRIP; DRIP36; TRAP36; HSPC126
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 4
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 4
UniProt Gene Name
MED4
UniProt Synonym Gene Names
ARC36; DRIP36; VDRIP; ARC36; DRIP36
UniProt Entry Name
MED4_HUMAN

NCBI Description

This gene encodes a component of the Mediator complex. The Mediator complex interacts with DNA-binding gene-specific transcription factors to modulate transcription by RNA polymerase II. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

MED4: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Belongs to the Mediator complex subunit 4 family.

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: nucleoplasm; membrane; Srb-mediator complex; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor transcription coactivator activity; vitamin D receptor binding; transcription cofactor activity; receptor activity; thyroid hormone receptor binding

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; steroid hormone receptor signaling pathway; transcription initiation from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; gene expression

Research Articles on MED4

Similar Products

Product Notes

The MED4 med4 (Catalog #AAA3209994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MED4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MED4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MED4 med4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APQYPWQSND MSMNMLPPNH SSDFLLEPPG HNKENEDDVE IMSTDSSSSS. It is sometimes possible for the material contained within the vial of "MED4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.