Western Blot (WB)
(WB Suggested Anti-NEK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Rabbit NEK3 Polyclonal Antibody | anti-NEK3 antibody
NEK3 antibody - N-terminal region
Gene Names
NEK3; HSPK36
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEK3; Polyclonal Antibody; NEK3 antibody - N-terminal region; anti-NEK3 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMA
Sequence Length
506
Applicable Applications for anti-NEK3 antibody
Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Yeast: 79%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NEK3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NEK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-NEK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Related Product Information for anti-NEK3 antibody
This is a rabbit polyclonal antibody against NEK3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.In Aspergillus nidulans, lack of the serine/threonine kinase NimA (never in mitosis A) results in cell cycle arrest in G2, while overexpression causes the premature onset of mitotic events. The protein encoded by this gene is similar in sequence to the Aspergillus nidulans protein and may therefore play a role in mitotic regulation. However, the encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. Three transcript variants have been found for this gene, but the full-length nature of only two of them has been characterized.
Target Description: NEK3 is a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. It differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase.In Aspergillus nidulans, lack of the serine/threonine kinase NimA (never in mitosis A) results in cell cycle arrest in G2, while overexpression causes the premature onset of mitotic events. The protein encoded by this gene is similar in sequence to the Aspergillus nidulans protein and may therefore play a role in mitotic regulation. However, the encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. Three transcript variants have been found for this gene, but the full-length nature of only two of them has been characterized.
Product Categories/Family for anti-NEK3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek3 isoform a
NCBI Official Synonym Full Names
NIMA related kinase 3
NCBI Official Symbol
NEK3
NCBI Official Synonym Symbols
HSPK36
NCBI Protein Information
serine/threonine-protein kinase Nek3
UniProt Protein Name
Serine/threonine-protein kinase Nek3
Protein Family
UniProt Gene Name
NEK3
UniProt Synonym Gene Names
NimA-related protein kinase 3
NCBI Description
This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase is activated by prolactin stimulation, leading to phosphorylation of VAV2 guanine nucleotide exchange factor, paxillin, and activation of the RAC1 GTPase. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2009]
Uniprot Description
Protein kinase which influences neuronal morphogenesis and polarity through effects on microtubules. Regulates microtubule acetylation in neurons. Contributes to prolactin-mediated phosphorylation of PXN and VAV2. Implicated in prolactin-mediated cytoskeletal reorganization and motility of breast cancer cells through mechanisms involving RAC1 activation and phosphorylation of PXN and VAV2.
Research Articles on NEK3
Similar Products
Product Notes
The NEK3 nek3 (Catalog #AAA3209314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEK3 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NEK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEK3 nek3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FTQMCLGVNH IHKKRVLHRD IKSKNIFLTQ NGKVKLGDFG SARLLSNPMA. It is sometimes possible for the material contained within the vial of "NEK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
