Western Blot (WB)
(WB Suggested Anti-Hat1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Pancreas)
Rabbit Hat1 Polyclonal Antibody | anti-HAT1 antibody
Hat1 Antibody - N-terminal region
Reactivity
Tested Species Reactivity: RatPredicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hat1; Polyclonal Antibody; Hat1 Antibody - N-terminal region; anti-HAT1 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Rat
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRV
Sequence Length
419
Applicable Applications for anti-HAT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hat1
Protein Size (# AA)
419 amino acids
Protein Name
Histone acetyltransferase type B catalytic subunit
Replacement Items
This antibody may replace item sc-366092 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Hat1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Pancreas)
Western Blot (WB)
(WB Suggested Anti-Hat1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Pancreas)
Related Product Information for anti-HAT1 antibody
This is a rabbit polyclonal antibody against Hat1. It was validated on Western Blot
Target Description: Hat1 acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Hat1 has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Hat1 may be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes.
Target Description: Hat1 acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Hat1 has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. Hat1 may be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes.
Product Categories/Family for anti-HAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
histone acetyltransferase type B catalytic subunit
NCBI Official Synonym Full Names
histone acetyltransferase 1
NCBI Official Symbol
Hat1
NCBI Protein Information
histone acetyltransferase type B catalytic subunit
UniProt Protein Name
Histone acetyltransferase type B catalytic subunit
Protein Family
UniProt Gene Name
Hat1
Uniprot Description
Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes.
Similar Products
Product Notes
The HAT1 hat1 (Catalog #AAA3209089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hat1 Antibody - N-terminal region reacts with Tested Species Reactivity: Rat Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hat1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAT1 hat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPEDLENDIR TFFPEYTHQL FGDDETAFGY KGLKILLYYI AGSLSTMFRV. It is sometimes possible for the material contained within the vial of "Hat1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
