Western Blot (WB)
(WB Suggested Anti-C3orf31 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Rabbit C3orf31 Polyclonal Antibody | anti-TAMM41 antibody
C3orf31 antibody - middle region
Gene Names
TAMM41; RAM41; TAM41; C3orf31
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C3orf31; Polyclonal Antibody; C3orf31 antibody - middle region; anti-TAMM41 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS
Sequence Length
316
Applicable Applications for anti-TAMM41 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C3orf31
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C3orf31 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-C3orf31 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-TAMM41 antibody
This is a rabbit polyclonal antibody against C3orf31. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Target Description: C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Product Categories/Family for anti-TAMM41 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
phosphatidate cytidylyltransferase, mitochondrial isoform b
NCBI Official Synonym Full Names
TAM41 mitochondrial translocator assembly and maintenance homolog
NCBI Official Symbol
TAMM41
NCBI Official Synonym Symbols
RAM41; TAM41; C3orf31
NCBI Protein Information
phosphatidate cytidylyltransferase, mitochondrial
UniProt Protein Name
Phosphatidate cytidylyltransferase, mitochondrial
UniProt Gene Name
TAMM41
UniProt Synonym Gene Names
C3orf31; CDP-DAG synthase; TAM41
UniProt Entry Name
TAM41_HUMAN
Uniprot Description
TAMM41: May be involved in the translocation of transit peptide- containing proteins across the mitochondrial inner membrane. Belongs to the MMP37/TAM41 family.
Protein type: EC 2.7.7.41
Chromosomal Location of Human Ortholog: 3p25.2
Molecular Function: phosphatidate cytidylyltransferase activity
Biological Process: cardiolipin biosynthetic process; CDP-diacylglycerol biosynthetic process
Research Articles on TAMM41
Similar Products
Product Notes
The TAMM41 tamm41 (Catalog #AAA3208730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3orf31 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C3orf31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAMM41 tamm41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPKTLQQQIN HIMDPPGKNR DVEETLFQVA HDPDCGDVVR LGLKKSVIYS. It is sometimes possible for the material contained within the vial of "C3orf31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
