Western Blot (WB)
(WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Rabbit ZKSCAN1 Polyclonal Antibody | anti-ZKSCAN1 antibody
ZKSCAN1 antibody - N-terminal region
Gene Names
ZKSCAN1; KOX18; ZNF36; PHZ-37; ZNF139; ZSCAN33
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ZKSCAN1; Polyclonal Antibody; ZKSCAN1 antibody - N-terminal region; anti-ZKSCAN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NTKEQILELLVLEQFLSILPKELQVWLQEYRPDSGEEAVTLLEDLELDLS
Sequence Length
563
Applicable Applications for anti-ZKSCAN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZKSCAN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ZKSCAN1 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ZKSCAN1 antibody
This is a rabbit polyclonal antibody against ZKSCAN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZKSCAN1 may be involved in transcriptional regulation.
Target Description: ZKSCAN1 may be involved in transcriptional regulation.
Product Categories/Family for anti-ZKSCAN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
zinc finger protein with KRAB and SCAN domains 1 isoform a
NCBI Official Synonym Full Names
zinc finger with KRAB and SCAN domains 1
NCBI Official Symbol
ZKSCAN1
NCBI Official Synonym Symbols
KOX18; ZNF36; PHZ-37; ZNF139; ZSCAN33
NCBI Protein Information
zinc finger protein with KRAB and SCAN domains 1
UniProt Protein Name
Zinc finger protein with KRAB and SCAN domains 1
Protein Family
UniProt Gene Name
ZKSCAN1
UniProt Synonym Gene Names
KOX18; ZNF139; ZNF36
UniProt Entry Name
ZKSC1_HUMAN
NCBI Description
This gene encodes a member of the Kruppel C2H2-type zinc-finger family of proteins. This encoded protein may function as a transcription factor that regulates the expression of GABA type-A receptors in the brain. Transcripts from this gene have been shown to form stable and abundant circular RNAs. Elevated expression of this gene has been observed in gastric cancer and the encoded protein may stimulate migration and invasion of human gastric cancer cells. [provided by RefSeq, Oct 2016]
Research Articles on ZKSCAN1
Similar Products
Product Notes
The ZKSCAN1 zkscan1 (Catalog #AAA3208646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZKSCAN1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZKSCAN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZKSCAN1 zkscan1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NTKEQILELL VLEQFLSILP KELQVWLQEY RPDSGEEAVT LLEDLELDLS. It is sometimes possible for the material contained within the vial of "ZKSCAN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
