Western Blot (WB)
(Sample Type: Human, MouseSample: HEK293 cells (10ug, 50ug)Dilution: 1:1000)
Rabbit Sumo3 Polyclonal Antibody | anti-SUMO3 antibody
Sumo3 Antibody - N-terminal region
Gene Names
Sumo3; SMT3A; SUMO-3; Smt3h1; D10Ertd345e; 2810014B19Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Sumo3; Polyclonal Antibody; Sumo3 Antibody - N-terminal region; anti-SUMO3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR
Sequence Length
110
Applicable Applications for anti-SUMO3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Sumo3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Human, MouseSample: HEK293 cells (10ug, 50ug)Dilution: 1:1000)
Western Blot (WB)
(Sample Type: Human, MouseSample: HEK293 cells (10ug, 50ug)Dilution: 1:1000)
Western Blot (WB)
(Sumo3 Antibody - N-terminal region validated by WB using Mouse Heart lysate at 1ug/ml.)
Western Blot (WB)
(Sumo3 Antibody - N-terminal region validated by WB using Mouse Heart lysate at 1ug/ml.)
Related Product Information for anti-SUMO3 antibody
This is a rabbit polyclonal antibody against Sumo3. It was validated on Western Blot
Target Description: Sumo3 is a ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. It does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. It plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
Target Description: Sumo3 is a ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. It does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. It plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4.
Product Categories/Family for anti-SUMO3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
small ubiquitin-related modifier 3 isoform 1
NCBI Official Synonym Full Names
small ubiquitin-like modifier 3
NCBI Official Symbol
Sumo3
NCBI Official Synonym Symbols
SMT3A; SUMO-3; Smt3h1; D10Ertd345e; 2810014B19Rik
NCBI Protein Information
small ubiquitin-related modifier 3
UniProt Protein Name
Small ubiquitin-related modifier 3
Protein Family
UniProt Gene Name
Sumo3
UniProt Synonym Gene Names
Smt3b; Smt3h1; SUMO-3; Smt3B
UniProt Entry Name
SUMO3_MOUSE
NCBI Description
This gene encodes a member of the small ubiquitin-like modifier family. The encoded protein may regulate a variety of proteins in many pathways via a post-translational modification, known as SUMOylation. This activity may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Disruption of some of these processes has been associated with cerebral ischemia, neural dysfunction, and heart disease. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Research Articles on SUMO3
Similar Products
Product Notes
The SUMO3 sumo3 (Catalog #AAA3207937) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Sumo3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Sumo3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUMO3 sumo3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PKEGVKTEND HINLKVAGQD GSVVQFKIKR HTPLSKLMKA YCERQGLSMR. It is sometimes possible for the material contained within the vial of "Sumo3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
