Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Mouse GutApplication: ImmunohistochemistrySpecies+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopHow many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut TissuePrimary antibody dilution: 1:50Secondary antibody: Goat anti-rabbit-cy3Secondary antibody dilution: 1:1500)

Rabbit SYP Polyclonal Antibody | anti-SYP antibody

SYP antibody - N-terminal region

Gene Names
SYP; MRX96; MRXSYP
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SYP; Polyclonal Antibody; SYP antibody - N-terminal region; anti-SYP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
Sequence Length
313
Applicable Applications for anti-SYP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SYP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Mouse GutApplication: ImmunohistochemistrySpecies+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopHow many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut TissuePrimary antibody dilution: 1:50Secondary antibody: Goat anti-rabbit-cy3Secondary antibody dilution: 1:1500)

Immunohistochemistry (IHC) (Sample Type: Mouse GutApplication: ImmunohistochemistrySpecies+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopHow many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut TissuePrimary antibody dilution: 1:50Secondary antibody: Goat anti-rabbit-cy3Secondary antibody dilution: 1:1500)
Related Product Information for anti-SYP antibody
This is a rabbit polyclonal antibody against SYP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells. Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SYP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
synaptophysin
NCBI Official Synonym Full Names
synaptophysin
NCBI Official Symbol
SYP
NCBI Official Synonym Symbols
MRX96; MRXSYP
NCBI Protein Information
synaptophysin
UniProt Protein Name
Synaptophysin
Protein Family
UniProt Gene Name
SYP
UniProt Entry Name
SYPH_HUMAN

NCBI Description

This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]

Research Articles on SYP

Similar Products

Product Notes

The SYP syp (Catalog #AAA3207755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYP antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SYP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SYP syp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLLLADMDVV NQLVAGGQFR VVKEPLGFVK VLQWVFAIFA FATCGSYSGE. It is sometimes possible for the material contained within the vial of "SYP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.