Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CISD2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

Rabbit CISD2 Polyclonal Antibody | anti-CISD2 antibody

CISD2 antibody - N-terminal region

Gene Names
CISD2; ERIS; WFS2; ZCD2; NAF-1; Miner1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CISD2; Polyclonal Antibody; CISD2 antibody - N-terminal region; anti-CISD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
Sequence Length
135
Applicable Applications for anti-CISD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CISD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CISD2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CISD2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-CISD2 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-CISD2 antibody
This is a rabbit polyclonal antibody against CISD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Product Categories/Family for anti-CISD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
CDGSH iron-sulfur domain-containing protein 2
NCBI Official Synonym Full Names
CDGSH iron sulfur domain 2
NCBI Official Symbol
CISD2
NCBI Official Synonym Symbols
ERIS; WFS2; ZCD2; NAF-1; Miner1
NCBI Protein Information
CDGSH iron-sulfur domain-containing protein 2
UniProt Protein Name
CDGSH iron-sulfur domain-containing protein 2
UniProt Gene Name
CISD2
UniProt Synonym Gene Names
CDGSH2; ERIS; ZCD2; Miner1; NAF-1
UniProt Entry Name
CISD2_HUMAN

NCBI Description

The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]

Uniprot Description

CISD2: a single-pass membrane protein of the endoplasmic reticulum that regulates autophagy. Has also been reported to localize to the mitochondrion outer membrane. Antagonizes ATG6-mediated cellular autophagy. Participates in the interaction of BCL2 with BECN1 and is required for BCL2-mediated depression of endoplasmic reticulum Ca2+ stores during autophagy. Contributes to BIK-initiated autophagy, while it is not involved in BIK-dependent activation of caspases. Involved in life span control, probably via its function as regulator of autophagy. Directly interacts with BCL2; the interaction is disrupted by BIK interaction with BCL2. It has been reported to mainly localizes to the mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome 2 (WFS2), is a rare autosomal recessive disorder characterized by optic atrophy and diabetes mellitus. Other symptoms include the presence of profound upper gastrointestinal ulceration, significant bleeding tendency, defective platelet aggregation with collagen and various neurological symptoms. Initially thought to be a zinc-finger protein, it was later shown to bind 1 2Fe-2S cluster instead.

Protein type: Autophagy; Endoplasmic reticulum; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: mitochondrial outer membrane; endoplasmic reticulum membrane; protein complex; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: 2 iron, 2 sulfur cluster binding; protein binding; protein homodimerization activity; metal ion binding

Biological Process: mitochondrion degradation; multicellular organismal aging; regulation of autophagy

Disease: Wolfram Syndrome 2

Research Articles on CISD2

Similar Products

Product Notes

The CISD2 cisd2 (Catalog #AAA3207430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CISD2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CISD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CISD2 cisd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLESVARIVK VQLPAYLKRL PVPESITGFA RLTVSEWLRL LPFLGVLALL. It is sometimes possible for the material contained within the vial of "CISD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.