Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human PancreasAnti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit GP2 Polyclonal Antibody | anti-GP2 antibody

GP2 antibody - middle region

Gene Names
GP2; ZAP75
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GP2; Polyclonal Antibody; GP2 antibody - middle region; anti-GP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Sequence Length
390
Applicable Applications for anti-GP2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 79%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human PancreasAnti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human PancreasAnti-GP2 antibody IHC staining of human pancreas. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Western Blot (WB)

(Host: RabbitTarget Name: GP2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GP2Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GP2Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GP2 is expressed in HepG2)

Western Blot (WB) (Host: RabbitTarget Name: GP2Sample Type: HepG2Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GP2 is expressed in HepG2)

Western Blot (WB)

(Host: RabbitTarget Name: GP2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GP2Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-GP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-GP2 antibody
This is a rabbit polyclonal antibody against GP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Product Categories/Family for anti-GP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
pancreatic secretory granule membrane major glycoprotein GP2 isoform 3
NCBI Official Synonym Full Names
glycoprotein 2
NCBI Official Symbol
GP2
NCBI Official Synonym Symbols
ZAP75
NCBI Protein Information
pancreatic secretory granule membrane major glycoprotein GP2
UniProt Protein Name
Pancreatic secretory granule membrane major glycoprotein GP2
Protein Family
UniProt Gene Name
GP2
UniProt Entry Name
GP2_HUMAN

NCBI Description

This gene encodes an integral membrane protein that is secreted from intracellular zymogen granules and associates with the plasma membrane via glycosylphosphatidylinositol (GPI) linkage. The encoded protein binds pathogens such as enterobacteria, thereby playing an important role in the innate immune response. The C-terminus of this protein is related to the C-terminus of the protein encoded by the neighboring gene, uromodulin (UMOD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

GP2: 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: apical plasma membrane

Molecular Function: antigen binding

Biological Process: antigen transcytosis by M cells in mucosal-associated lymphoid tissue

Research Articles on GP2

Similar Products

Product Notes

The GP2 gp2 (Catalog #AAA3207429) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GP2 antibody - middle region reacts with Cow, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GP2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GP2 gp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLQAALQPIV SSLNVSVDGN GEFIVRMALF QDQNYTNPYE GDAVELSVES. It is sometimes possible for the material contained within the vial of "GP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.