Western Blot (WB)
(WB Suggested Anti-FCRL6 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)
Rabbit anti-Human FCRL6 Polyclonal Antibody | anti-FCRL6 antibody
FCRL6 antibody - middle region
Gene Names
FCRL6; FcRH6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCRL6; Polyclonal Antibody; FCRL6 antibody - middle region; anti-FCRL6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQ
Sequence Length
434
Applicable Applications for anti-FCRL6 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FCRL6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FCRL6 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-FCRL6 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysate)
Related Product Information for anti-FCRL6 antibody
This is a rabbit polyclonal antibody against FCRL6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-FCRL6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
Fc receptor-like protein 6 isoform 2
NCBI Official Synonym Full Names
Fc receptor like 6
NCBI Official Symbol
FCRL6
NCBI Official Synonym Symbols
FcRH6
NCBI Protein Information
Fc receptor-like protein 6
UniProt Protein Name
Fc receptor-like protein 6
Protein Family
UniProt Gene Name
FCRL6
UniProt Synonym Gene Names
FCRH6; FcR-like protein 6; FcRL6; FcRH6
UniProt Entry Name
FCRL6_HUMAN
Uniprot Description
Subunit structure: Interacts with PTPN11. Ref.1
Subcellular location: Membrane; Single-pass type I membrane protein
Potential.
Tissue specificity: Expressed by cytolytic cells including NK cells, effector and effector-memory CD8+ T-cells. Expression among T-cells is greatly expanded in HIV-1 infected individuals, and includes not only effector and effector-memory CD8+ T-cells but also populations of CD4+ T-cells. Ref.1
Domain: Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). The phosphorylated ITIM motif is involved in PTPN11 binding. Ref.1
Post-translational modification: Phosphorylated on Tyr residue, inducing association with PTPN11. Ref.1
Sequence similarities: Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
Research Articles on FCRL6
Similar Products
Product Notes
The FCRL6 fcrl6 (Catalog #AAA3207386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCRL6 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FCRL6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FCRL6 fcrl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRLLFSFHKD GHTLQDRGPH PELCIPGAKE GDSGLYWCEV APEGGQVQKQ. It is sometimes possible for the material contained within the vial of "FCRL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
