Rabbit anti-Human NAT2 Polyclonal Antibody | anti-NAT2 antibody

NAT2 antibody - middle region

Cat. Num. AAA3207254

• Gene Names: NAT2; AAC2; PNAT; NAT-2
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: NAT2; Polyclonal Antibody; NAT2 antibody - middle region; anti-NAT2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Specificity: Antibody reacts with both NAT1 and NAT2
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT
• Sequence Length: 290

• Applicable Applications for anti-NAT2 antibody: Western Blot (WB)
• Homology: Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NAT2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB)

()

Related Product Information for anti-NAT2 antibody

This is a rabbit polyclonal antibody against NAT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.

Product Categories/Family for anti-NAT2 antibody

Polyclonal; Membrane Protein; Drugs and Drug Metabolism; Cell Biology; Immunology; Membrane & Traffic

NCBI and Uniprot Product Information

• NCBI GI #: 116295260
• NCBI GeneID: 10
• NCBI Accession #: NP_000006
• NCBI GenBank Nucleotide #: NM_000015
• UniProt Accession #: P11245
• Molecular Weight: 33kDa
• NCBI Official Full Name: arylamine N-acetyltransferase 2
• NCBI Official Synonym Full Names: N-acetyltransferase 2
• NCBI Official Symbol: NAT2
• NCBI Official Synonym Symbols: AAC2; PNAT; NAT-2
• NCBI Protein Information: arylamine N-acetyltransferase 2
• UniProt Protein Name: Arylamine N-acetyltransferase 2
• Protein Family: N-terminal acetyltransferase
• UniProt Gene Name: NAT2
• UniProt Synonym Gene Names: AAC2; NAT-2; PNAT
• UniProt Entry Name: ARY2_HUMAN

NCBI Description

This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq, Jul 2008]