Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SLC24A4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Rabbit SLC24A4 Polyclonal Antibody | anti-SLC24A4 antibody

SLC24A4 antibody - N-terminal region

Gene Names
SLC24A4; AI2A5; NCKX4; SHEP6; SLC24A2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC24A4; Polyclonal Antibody; SLC24A4 antibody - N-terminal region; anti-SLC24A4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTI
Sequence Length
605
Applicable Applications for anti-SLC24A4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC24A4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SLC24A4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-SLC24A4 Antibody Titration: 0.2-1 ug/mlPositive Control: HT1080 cell lysate)
Related Product Information for anti-SLC24A4 antibody
This is a rabbit polyclonal antibody against SLC24A4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Potassium-dependent sodium/calcium exchangers, such as NCKX4, are thought to transport 1 intracellular calcium and 1 potassium ion in exchange for 4 extracellular sodium ions (Li et al., 2002 [PubMed 12379639]).
Product Categories/Family for anti-SLC24A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
sodium/potassium/calcium exchanger 4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 24 member 4
NCBI Official Symbol
SLC24A4
NCBI Official Synonym Symbols
AI2A5; NCKX4; SHEP6; SLC24A2
NCBI Protein Information
sodium/potassium/calcium exchanger 4
UniProt Protein Name
Sodium/potassium/calcium exchanger 4
UniProt Gene Name
SLC24A4
UniProt Synonym Gene Names
NCKX4
UniProt Entry Name
NCKX4_HUMAN

NCBI Description

This gene encodes a member of the potassium-dependent sodium/calcium exchanger protein family. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010]

Uniprot Description

SLC24A4: Transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+). Belongs to the sodium/potassium/calcium exchanger family. SLC24A subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: 14q32.12

Cellular Component: membrane; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: calcium, potassium:sodium antiporter activity; symporter activity

Biological Process: cellular calcium ion homeostasis; response to stimulus; sensory perception of smell; ion transport; transmembrane transport; potassium ion transport

Disease: Skin/hair/eye Pigmentation, Variation In, 6

Research Articles on SLC24A4

Similar Products

Product Notes

The SLC24A4 slc24a4 (Catalog #AAA3207222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC24A4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SLC24A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC24A4 slc24a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSLEKICERL HLSEDVAGAT FMAAGSSTPE LFASVIGVFI THGDVGVGTI. It is sometimes possible for the material contained within the vial of "SLC24A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.