Rabbit anti-Horse, Human MMP1 Polyclonal Antibody | anti-MMP1 antibody

MMP1 antibody - N-terminal region

Cat. Num. AAA3206168

• Gene Names: MMP1; CLG; CLGN
• Reactivity: Horse, Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Protein A purified
• Synonyms: MMP1; Polyclonal Antibody; MMP1 antibody - N-terminal region; anti-MMP1 antibody

• Host: Rabbit
• Reactivity: Horse, Human
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
• Sequence Length: 469

• Applicable Applications for anti-MMP1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Horse: 77%; Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Colorectal cancer sampleHuman Liver Sample)

Immunohistochemistry (IHC)

(MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain.Antibody Titration: 2-10ug/mlPositive Control: Human epithelial cells ovarian carcinoma)

Immunohistochemistry (IHC)

(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(species sample : Humancell/tissue :macrophagesHuman macrophagesdilution :1/200)

Western Blot (WB)

(Sample Type: Equine cartilage explantsSample Type: Equine Cartilage ExplantsPrimary Dilution: 1:800Secondary Antibody: Bio-Rad 170-5046Secondary Dilution::100,000Image Submitted By: Adam WilliamsUniversity of Nottingham)

Western Blot (WB)

(Host: RabbitTarget Name: MMP1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-MMP1 AntibodyPositive Control: Lane 1: 15ug HT29 cell lysate Lane 2: 15ug HT29 cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Zhongsheng Peng, School of Medicine, University of Maryland Baltimore)

Western Blot (WB)

(WB Suggested Anti-MMP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Related Product Information for anti-MMP1 antibody

This is a rabbit polyclonal antibody against MMP1. It was validated on Western Blot and immunohistochemistry

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

Product Categories/Family for anti-MMP1 antibody

Polyclonal; Signal Proteins; Drugs and Drug Metabolism; Developmental Biology; Disease Related; Tissue Specific & Cell Marker; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 4505215
• NCBI GeneID: 4312
• NCBI Accession #: NP_002412
• NCBI GenBank Nucleotide #: NM_002421
• UniProt Accession #: P03956
• Molecular Weight: 54kDa
• NCBI Official Full Name: interstitial collagenase isoform 1 preproprotein
• NCBI Official Synonym Full Names: matrix metallopeptidase 1
• NCBI Official Symbol: MMP1
• NCBI Official Synonym Symbols: CLG; CLGN
• NCBI Protein Information: interstitial collagenase
• UniProt Protein Name: Interstitial collagenase
• Protein Family: Interstitial collagenase
• UniProt Gene Name: MMP1
• UniProt Synonym Gene Names: CLG; MMP-1
• UniProt Entry Name: MMP1_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP1: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity. Belongs to the peptidase M10A family.

Protein type: Protease; Secreted, signal peptide; EC 3.4.24.7; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 11q22.3

Cellular Component: proteinaceous extracellular matrix; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity; endopeptidase activity; calcium ion binding

Biological Process: positive regulation of protein oligomerization; extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; cellular protein metabolic process; viral reproduction; blood coagulation; proteolysis; leukocyte migration

Disease: Epidermolysis Bullosa Dystrophica, Autosomal Recessive; Pulmonary Disease, Chronic Obstructive