Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0ug/ml using anti-PNPT1 antibody )

Rabbit PNPT1 Polyclonal Antibody | anti-PNPT1 antibody

PNPT1 antibody - middle region

Gene Names
PNPT1; OLD35; DFNB70; PNPASE; old-35; COXPD13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PNPT1; Polyclonal Antibody; PNPT1 antibody - middle region; anti-PNPT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CGGSLALMDSGVPISSAVAGVAIGLVTKTDPEKGEIEDYRLLTDILGIED
Sequence Length
783
Applicable Applications for anti-PNPT1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PNPT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0ug/ml using anti-PNPT1 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0ug/ml using anti-PNPT1 antibody )
Related Product Information for anti-PNPT1 antibody
This is a rabbit polyclonal antibody against PNPT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation.PNPT1 is a subunit of the exosome complex, which is involved in 3-prime-to-5-prime exoribonuclease activity for RNA processing and degradation (Raijmakers et al., 2002 [PubMed 12419256]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
polyribonucleotide nucleotidyltransferase 1, mitochondrial
NCBI Official Synonym Full Names
polyribonucleotide nucleotidyltransferase 1
NCBI Official Symbol
PNPT1
NCBI Official Synonym Symbols
OLD35; DFNB70; PNPASE; old-35; COXPD13
NCBI Protein Information
polyribonucleotide nucleotidyltransferase 1, mitochondrial
UniProt Protein Name
Polyribonucleotide nucleotidyltransferase 1, mitochondrial
UniProt Gene Name
PNPT1
UniProt Synonym Gene Names
PNPASE; PNPase 1
UniProt Entry Name
PNPT1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the evolutionary conserved polynucleotide phosphorylase family comprised of phosphate dependent 3'-to-5' exoribonucleases implicated in RNA processing and degradation. This enzyme is predominantly localized in the mitochondrial intermembrane space and is involved in import of RNA to mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency-13 and autosomal recessive nonsyndromic deafness-70. Related pseudogenes are found on chromosomes 3 and 7. [provided by RefSeq, Dec 2012]

Uniprot Description

PNPT1: RNA-binding protein implicated in numerous RNA metabolic processes. Hydrolyzes single-stranded polyribonucleotides processively in the 3'-to-5' direction. Mitochondrial intermembrane factor with RNA-processing exoribonulease activity. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. Required for correct processing and polyadenylation of mitochondrial mRNAs. Plays a role as a cytoplasmic RNA import factor that mediates the translocation of small RNA components, like the 5S RNA, the RNA subunit of ribonuclease P and the mitochondrial RNA-processing (MRP) RNA, into the mitochondrial matrix. Plays a role in mitochondrial morphogenesis and respiration; regulates the expression of the electron transport chain (ETC) components at the mRNA and protein levels. In the cytoplasm, shows a 3'-to-5' exoribonuclease mediating mRNA degradation activity; degrades c- myc mRNA upon treatment with IFNB1/IFN-beta, resulting in a growth arrest in melanoma cells. Regulates the stability of specific mature miRNAs in melanoma cells; specifically and selectively degrades miR-221, preferentially. Plays also a role in RNA cell surveillance by cleaning up oxidized RNAs. Binds to the RNA subunit of ribonuclease P, MRP RNA and miR-221 microRNA. Belongs to the polyribonucleotide nucleotidyltransferase family.

Protein type: Mitochondrial; Nucleotide Metabolism - purine; EC 2.7.7.8; Nucleotide Metabolism - pyrimidine; Transferase; RNA-binding

Chromosomal Location of Human Ortholog: 2p15

Cellular Component: membrane; mitochondrion; cytoplasm; mitochondrial intermembrane space

Molecular Function: 3'-5'-exoribonuclease activity; protein binding; miRNA binding; poly(U) binding; polyribonucleotide nucleotidyltransferase activity; poly(rG) binding

Biological Process: regulation of cellular respiration; RNA polyadenylation; RNA catabolic process; mRNA catabolic process; protein homooligomerization; negative regulation of growth

Disease: Deafness, Autosomal Recessive 70; Combined Oxidative Phosphorylation Deficiency 13

Research Articles on PNPT1

Similar Products

Product Notes

The PNPT1 pnpt1 (Catalog #AAA3205626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNPT1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PNPT1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PNPT1 pnpt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CGGSLALMDS GVPISSAVAG VAIGLVTKTD PEKGEIEDYR LLTDILGIED. It is sometimes possible for the material contained within the vial of "PNPT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.