Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit BRUNOL5 Polyclonal Antibody | anti-CELF5 antibody

BRUNOL5 antibody - middle region

Gene Names
CELF5; CELF-5; BRUNOL5; BRUNOL-5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BRUNOL5; Polyclonal Antibody; BRUNOL5 antibody - middle region; anti-CELF5 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP
Sequence Length
485
Applicable Applications for anti-CELF5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 90%; Pig: 100%; Rabbit: 79%; Rat: 90%; Yeast: 91%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BRUNOL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BRUNOL5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: A549 cell lysate)

Related Product Information for anti-CELF5 antibody
This is a rabbit polyclonal antibody against BRUNOL5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.
Product Categories/Family for anti-CELF5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
CUGBP Elav-like family member 5 isoform 1
NCBI Official Synonym Full Names
CUGBP Elav-like family member 5
NCBI Official Symbol
CELF5
NCBI Official Synonym Symbols
CELF-5; BRUNOL5; BRUNOL-5
NCBI Protein Information
CUGBP Elav-like family member 5
UniProt Protein Name
CUGBP Elav-like family member 5
Protein Family
UniProt Gene Name
CELF5
UniProt Synonym Gene Names
BRUNOL5; CELF-5
UniProt Entry Name
CELF5_HUMAN

NCBI Description

This gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]

Similar Products

Product Notes

The CELF5 celf5 (Catalog #AAA3205571) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BRUNOL5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BRUNOL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CELF5 celf5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFSGVQQYTA MYPTAAITPI AHSVPQPPPL LQQQQREGPE GCNLFIYHLP. It is sometimes possible for the material contained within the vial of "BRUNOL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual