Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STAU2Sample Tissue: Human Lymph TumorAntibody Dilution: 1ug/ml)

Rabbit STAU2 Polyclonal Antibody | anti-STAU2 antibody

STAU2 Antibody - C-terminal region

Gene Names
STAU2; 39K2; 39K3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STAU2; Polyclonal Antibody; STAU2 Antibody - C-terminal region; anti-STAU2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASR
Sequence Length
398
Applicable Applications for anti-STAU2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human STAU2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STAU2Sample Tissue: Human Lymph TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STAU2Sample Tissue: Human Lymph TumorAntibody Dilution: 1ug/ml)
Related Product Information for anti-STAU2 antibody
This is a rabbit polyclonal antibody against STAU2. It was validated on Western Blot

Target Description: Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-STAU2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
Double-stranded RNA-binding protein Staufen homolog 2
NCBI Official Synonym Full Names
staufen double-stranded RNA binding protein 2
NCBI Official Symbol
STAU2
NCBI Official Synonym Symbols
39K2; 39K3
NCBI Protein Information
double-stranded RNA-binding protein Staufen homolog 2
UniProt Protein Name
Double-stranded RNA-binding protein Staufen homolog 2
UniProt Gene Name
STAU2
UniProt Entry Name
STAU2_HUMAN

NCBI Description

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]

Uniprot Description

STAU2: RNA-binding protein required for the microtubule- dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 8q21.11

Cellular Component: microtubule; membrane; endoplasmic reticulum; nucleolus

Molecular Function: protein binding; double-stranded RNA binding

Biological Process: transport

Research Articles on STAU2

Similar Products

Product Notes

The STAU2 stau2 (Catalog #AAA3205463) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAU2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAU2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STAU2 stau2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STNLQDQLEK TGENKGWSGP KPGFPEPTNN TPKGILHLSP DVYQEMEASR. It is sometimes possible for the material contained within the vial of "STAU2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.