Western Blot (WB)
(WB Suggested Anti-ISG20 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysateISG20 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)
Rabbit ISG20 Polyclonal Antibody | anti-ISG20 antibody
ISG20 antibody - N-terminal region
Gene Names
ISG20; CD25; HEM45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ISG20; Polyclonal Antibody; ISG20 antibody - N-terminal region; anti-ISG20 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
Sequence Length
181
Applicable Applications for anti-ISG20 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ISG20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ISG20 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysateISG20 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)
Western Blot (WB)
(WB Suggested Anti-ISG20 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Daudi cell lysateISG20 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)
Related Product Information for anti-ISG20 antibody
This is a rabbit polyclonal antibody against ISG20. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Target Description: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.
Product Categories/Family for anti-ISG20 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
interferon-stimulated gene 20 kDa protein isoform a
NCBI Official Synonym Full Names
interferon stimulated exonuclease gene 20
NCBI Official Symbol
ISG20
NCBI Official Synonym Symbols
CD25; HEM45
NCBI Protein Information
interferon-stimulated gene 20 kDa protein
UniProt Protein Name
Interferon-stimulated gene 20 kDa protein
Protein Family
UniProt Gene Name
ISG20
UniProt Synonym Gene Names
HEM45
UniProt Entry Name
ISG20_HUMAN
Research Articles on ISG20
Similar Products
Product Notes
The ISG20 isg20 (Catalog #AAA3205195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISG20 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ISG20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ISG20 isg20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAVLYDKFIR PEGEITDYRT RVSGVTPQHM VGATPFAVAR LEILQLLKGK. It is sometimes possible for the material contained within the vial of "ISG20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
