Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Rabbit BCL11A Polyclonal Antibody | anti-BCL11A antibody

BCL11A antibody - C-terminal region

Gene Names
BCL11A; EVI9; CTIP1; DILOS; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; BCL11A-XL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BCL11A; Polyclonal Antibody; BCL11A antibody - C-terminal region; anti-BCL11A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YACAQSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDR
Sequence Length
835
Applicable Applications for anti-BCL11A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human BCL11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-BCL11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Related Product Information for anti-BCL11A antibody
This is a rabbit polyclonal antibody against BCL11A. It was validated on Western Blot

Target Description: BCL11A is a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
B-cell lymphoma/leukemia 11A isoform 1
NCBI Official Synonym Full Names
BAF chromatin remodeling complex subunit BCL11A
NCBI Official Symbol
BCL11A
NCBI Official Synonym Symbols
EVI9; CTIP1; DILOS; ZNF856; HBFQTL5; BCL11A-L; BCL11A-S; BCL11a-M; BCL11A-XL
NCBI Protein Information
B-cell lymphoma/leukemia 11A
UniProt Protein Name
B-cell lymphoma/leukemia 11A
Protein Family
UniProt Gene Name
BCL11A
UniProt Synonym Gene Names
CTIP1; EVI9; KIAA1809; ZNF856; BCL-11A; EVI-9
UniProt Entry Name
BC11A_HUMAN

NCBI Description

This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Bcl-11A: Functions as a myeloid and B-cell proto-oncogene. May play important roles in leukemogenesis and hematopoiesis. An essential factor in lymphopoiesis, is required for B-cell formation in fetal liver. May function as a modulator of the transcriptional repression activity of ARP1. Chromosomal aberrations involving BCL11A may be a cause of lymphoid malignancies. Translocation t(2;14)(p13;q32.3) causes BCL11A deregulation and amplification. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; C2H2-type zinc finger protein; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 2p16.1

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein homodimerization activity; protein heterodimerization activity; metal ion binding; transcription corepressor activity

Biological Process: protein sumoylation; transcription, DNA-dependent; B cell differentiation; regulation of dendrite development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of collateral sprouting; negative regulation of transcription from RNA polymerase II promoter; negative regulation of axon extension; positive regulation of collateral sprouting; negative regulation of protein homooligomerization; T cell differentiation

Research Articles on BCL11A

Similar Products

Product Notes

The BCL11A bcl11a (Catalog #AAA3204706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL11A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BCL11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BCL11A bcl11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YACAQSSKLT RHMKTHGQVG KDVYKCEICK MPFSVYSTLE KHMKKWHSDR. It is sometimes possible for the material contained within the vial of "BCL11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.