Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HIF1AN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit HIF1AN Polyclonal Antibody | anti-HIF1AN antibody

HIF1AN antibody - N-terminal region

Gene Names
HIF1AN; FIH1
Reactivity
Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIF1AN; Polyclonal Antibody; HIF1AN antibody - N-terminal region; anti-HIF1AN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDP
Sequence Length
349
Applicable Applications for anti-HIF1AN antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 93%; Pig: 79%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HIF1AN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HIF1AN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-HIF1AN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-HIF1AN antibody
This is a rabbit polyclonal antibody against HIF1AN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HIF1AN is a co-repressor that interacts with hypoxia-inducible factor 1 (HIF-1) alpha and the von Hippel-Lindau tumor suppressor protein to mediate repression of HIF-1 transcriptional activity.
Product Categories/Family for anti-HIF1AN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
hypoxia-inducible factor 1-alpha inhibitor
NCBI Official Synonym Full Names
hypoxia inducible factor 1 subunit alpha inhibitor
NCBI Official Symbol
HIF1AN
NCBI Official Synonym Symbols
FIH1
NCBI Protein Information
hypoxia-inducible factor 1-alpha inhibitor
UniProt Protein Name
Hypoxia-inducible factor 1-alpha inhibitor
UniProt Gene Name
HIF1AN
UniProt Synonym Gene Names
FIH1; FIH-1
UniProt Entry Name
HIF1N_HUMAN

Uniprot Description

HIF1AN: Hydroxylates HIF-1 alpha at 'Asp-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300- interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases. Hydroxylates specific Asn residues within ankyrin repeat domains (ARD) of NFKB1, NFKBIA, NOTCH1, ASB4, PPP1R12A and several other ARD-containing proteins. Also hydroxylates Asp and His residues within ARDs of ANK1 and TNKS2, respectively. Negatively regulates NOTCH1 activity, accelerating myogenic differentiation. Positively regulates ASB4 activity, promoting vascular differentiation. Homodimer; homodimerization is essential for catalytic activity. Interacts with VHL and HIF1A. Part of a complex with VHL, HIF1A and HDAC1 or HDAC2 or HDAC3. Interacts with NFKB1 and NFKBIA. Interacts with NOTCH1, NOTCH2 and NOTCH3 but not with NOTCH4. Interacts with APBA3; binding inhibits HIF1AN binding to HIF1A. Interacts with TNKS2. Interacts with PPP1R12A. Interacts with ASB4.

Protein type: EC 1.14.11.n4; Oxidoreductase; EC 1.14.11.30

Chromosomal Location of Human Ortholog: 10q24

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; nucleus; cytosol

Molecular Function: NF-kappaB binding; protein binding; protein homodimerization activity; oxygen sensor activity; zinc ion binding; carboxylic acid binding; iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors; cofactor binding; Notch binding

Biological Process: peptidyl-aspartic acid hydroxylation; transcription, DNA-dependent; negative regulation of Notch signaling pathway; peptidyl-asparagine hydroxylation; positive regulation of myoblast differentiation

Research Articles on HIF1AN

Similar Products

Product Notes

The HIF1AN hif1an (Catalog #AAA3204552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIF1AN antibody - N-terminal region reacts with Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's HIF1AN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIF1AN hif1an for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MAATAAEAVA SGSGEPREEA GALGPAWDES QLRSYSFPTR PIPRLSQSDP. It is sometimes possible for the material contained within the vial of "HIF1AN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.