Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung )

Rabbit ZNF16 Polyclonal Antibody | anti-ZNF16 antibody

ZNF16 antibody - N-terminal region

Gene Names
ZNF16; HZF1; KOX9
Reactivity
Human, Mouse, Pig
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZNF16; Polyclonal Antibody; ZNF16 antibody - N-terminal region; anti-ZNF16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC
Sequence Length
682
Applicable Applications for anti-ZNF16 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%; Mouse: 80%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(WB Suggested Anti-ZNF16 Antibody Titration: 0.03ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-ZNF16 Antibody Titration: 0.03ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-ZNF16 antibody
This is a rabbit polyclonal antibody against ZNF16. It was validated on Western Blot and immunohistochemistry

Target Description: ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
zinc finger protein 16
NCBI Official Synonym Full Names
zinc finger protein 16
NCBI Official Symbol
ZNF16
NCBI Official Synonym Symbols
HZF1; KOX9
NCBI Protein Information
zinc finger protein 16
UniProt Protein Name
Zinc finger protein 16
Protein Family
UniProt Gene Name
ZNF16
UniProt Synonym Gene Names
HZF1; KOX9

NCBI Description

The protein encoded by this gene contains multiple tandem zinc finger motifs. The encoded protein is involved in the differentiation of erythroid and megakaryocytic cells. This gene is located in a cluster of related genes on chromosome 8 encoding zinc finger proteins. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]

Uniprot Description

Acts as a transcriptional activator. Promotes cell proliferation by facilitating the cell cycle phase transition from the S to G2/M phase. Involved in both the hemin- and phorbol myristate acetate (PMA)-induced erythroid and megakaryocytic differentiation, respectively. Plays also a role as an inhibitor of cell apoptosis.

Research Articles on ZNF16

Similar Products

Product Notes

The ZNF16 znf16 (Catalog #AAA3204323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF16 antibody - N-terminal region reacts with Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF16 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZNF16 znf16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPSLRTRREE AEMELSVPGP SPWTPAAQAR VRDAPAVTHP GSAACGTPCC. It is sometimes possible for the material contained within the vial of "ZNF16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.