Western Blot (WB)
(Host: RabbitTarget Name: ZNF74Sample Tissue: Human Fetal LiverAntibody Dilution: 1ug/ml)
Rabbit ZNF74 Polyclonal Antibody | anti-ZNF74 antibody
ZNF74 Antibody - N-terminal region
Gene Names
ZNF74; COS52; hZNF7; ZFP520; ZNF520
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF74; Polyclonal Antibody; ZNF74 Antibody - N-terminal region; anti-ZNF74 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME
Sequence Length
573
Applicable Applications for anti-ZNF74 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 91%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF74
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ZNF74Sample Tissue: Human Fetal LiverAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ZNF74Sample Tissue: Human Fetal LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZNF74 antibody
This is a rabbit polyclonal antibody against ZNF74. It was validated on Western Blot
Target Description: ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
Target Description: ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
Product Categories/Family for anti-ZNF74 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
zinc finger
NCBI Official Synonym Full Names
zinc finger protein 74
NCBI Official Symbol
ZNF74
NCBI Official Synonym Symbols
COS52; hZNF7; ZFP520; ZNF520
NCBI Protein Information
zinc finger protein 74
UniProt Protein Name
Zinc finger protein 74
Protein Family
UniProt Gene Name
ZNF74
UniProt Synonym Gene Names
ZNF520
UniProt Entry Name
ZNF74_HUMAN
Uniprot Description
ZNF74: May play a role in RNA metabolism. Belongs to the krueppel C2H2-type zinc-finger protein family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: C2H2-type zinc finger protein; DNA-binding
Chromosomal Location of Human Ortholog: 22q11.21
Cellular Component: nucleoplasm; actin cytoskeleton
Molecular Function: DNA binding; RNA binding; metal ion binding; transcription factor activity
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; multicellular organismal development
Research Articles on ZNF74
Similar Products
Product Notes
The ZNF74 znf74 (Catalog #AAA3204017) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF74 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF74 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZNF74 znf74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VISHLERGEE PWSMQREVPR GPCPEWELKA VPSQQQGICK EEPAQEPIME. It is sometimes possible for the material contained within the vial of "ZNF74, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
