<
Western Blot (WB)
(Host: MouseTarget Name: E2F3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
Rabbit E2F3 Polyclonal Antibody | anti-E2F3 antibody
E2F3 antibody - C-terminal region
Gene Names
E2F3; E2F-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
E2F3; Polyclonal Antibody; E2F3 antibody - C-terminal region; anti-E2F3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Specificity
The immunizing peptide used to raise this antibody is 100% homologous to isoform 2 (334aa, 37kDa) of human E2F3.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Sequence Length
465
Applicable Applications for anti-E2F3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: E2F3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: E2F3Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: E2F3Sample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)
Western Blot (WB)
(WB Suggested Anti-E2F3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Thymus)
Related Product Information for anti-E2F3 antibody
This is a rabbit polyclonal antibody against E2F3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Target Description: E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Product Categories/Family for anti-E2F3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49kDa
NCBI Official Full Name
hypothetical protein
NCBI Official Synonym Full Names
E2F transcription factor 3
NCBI Official Symbol
E2F3
NCBI Official Synonym Symbols
E2F-3
NCBI Protein Information
transcription factor E2F3
Protein Family
NCBI Description
This gene encodes a member of a small family of transcription factors that function through binding of DP interaction partner proteins. The encoded protein recognizes a specific sequence motif in DNA and interacts directly with the retinoblastoma protein (pRB) to regulate the expression of genes involved in the cell cycle. Altered copy number and activity of this gene have been observed in a number of human cancers. There are pseudogenes for this gene on chromosomes 2 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]
Research Articles on E2F3
Similar Products
Product Notes
The E2F3 (Catalog #AAA3203891) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The E2F3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's E2F3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the E2F3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLQQTEDQIP SNLEGPFVNL LPPLLQEDYL LSLGEEEGIS DLFDAYDLEK. It is sometimes possible for the material contained within the vial of "E2F3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
