Western Blot (WB)
(WB Suggested Anti-TEF Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Rabbit TEF Polyclonal Antibody | anti-TEF antibody
TEF antibody - N-terminal region
Gene Names
Tef; 2310028D20Rik
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
TEF; Polyclonal Antibody; TEF antibody - N-terminal region; anti-TEF antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL
Sequence Length
301
Applicable Applications for anti-TEF antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 93%; Mouse: 100%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TEF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TEF Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TEF Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-TEF antibody
This is a rabbit polyclonal antibody against TEF. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TEF (thyrotroph embryonic factor) is a member of the PAR bZip (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It accumulates with robust circadian rhythms in tissues with high amplitudes of clock gene expression.
Target Description: TEF (thyrotroph embryonic factor) is a member of the PAR bZip (proline and acidic amino acid-rich basic leucine zipper) transcription factor family. It accumulates with robust circadian rhythms in tissues with high amplitudes of clock gene expression.
Product Categories/Family for anti-TEF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
thyrotroph embryonic factor isoform 1
NCBI Official Synonym Full Names
thyrotroph embryonic factor
NCBI Official Symbol
Tef
NCBI Official Synonym Symbols
2310028D20Rik
NCBI Protein Information
thyrotroph embryonic factor
UniProt Protein Name
Thyrotroph embryonic factor
Protein Family
UniProt Gene Name
Tef
UniProt Entry Name
TEF_MOUSE
Research Articles on TEF
Similar Products
Product Notes
The TEF tef (Catalog #AAA3203509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TEF antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TEF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TEF tef for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSDAGGGKKP PVEPQAGPGP GRAAGERGLS GSFPLVLKKL MENPPRETRL. It is sometimes possible for the material contained within the vial of "TEF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
