Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CBLSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CBL Polyclonal Antibody | anti-CBL antibody

CBL Antibody - C-terminal region

Gene Names
CBL; CBL2; NSLL; C-CBL; RNF55; FRA11B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CBL; Polyclonal Antibody; CBL Antibody - C-terminal region; anti-CBL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEGNLAAAHANTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSF
Sequence Length
906
Applicable Applications for anti-CBL antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CBL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CBLSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CBLSample Tissue: Human THP-1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CBL antibody
Cbl proto-oncogene, E3 ubiquitin protein ligase

Target Description: This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia. Mutations in this gene are also the cause of Noonan syndrome-like disorder.
Product Categories/Family for anti-CBL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
867
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase CBL
NCBI Official Synonym Full Names
Cbl proto-oncogene
NCBI Official Symbol
CBL
NCBI Official Synonym Symbols
CBL2; NSLL; C-CBL; RNF55; FRA11B
NCBI Protein Information
E3 ubiquitin-protein ligase CBL
UniProt Protein Name
E3 ubiquitin-protein ligase CBL
UniProt Gene Name
CBL
UniProt Synonym Gene Names
CBL2; RNF55
UniProt Entry Name
CBL_HUMAN

NCBI Description

This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia, and expansion of CGG repeats in the 5' UTR has been associated with Jacobsen syndrome. Mutations in this gene are also the cause of Noonan syndrome-like disorder. [provided by RefSeq, Jul 2016]

Uniprot Description

CBL: an adapter protein that functions as a negative regulator of many signaling pathways that start from receptors at the cell surface. Acts as an E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Recognizes activated receptor tyrosine kinases, including PDGFA, EGF and CSF1, and terminates signaling. Participates in signal transduction in hematopoietic cells.

Protein type: Ligase; EC 6.3.2.19; EC 6.3.2.-; Adaptor/scaffold; Oncoprotein; Motility/polarity/chemotaxis; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: cytoplasm; plasma membrane; flotillin complex; nucleus; cytosol

Molecular Function: protein binding; signal transducer activity; ephrin receptor binding; zinc ion binding; phosphotyrosine binding; ubiquitin-protein ligase activity; calcium ion binding; SH3 domain binding; transcription factor activity; ligase activity

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of epidermal growth factor receptor signaling pathway; positive regulation of phosphoinositide 3-kinase cascade; cell surface receptor linked signal transduction; fibroblast growth factor receptor signaling pathway; regulation of transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; protein ubiquitination; positive regulation of receptor-mediated endocytosis; negative regulation of apoptosis

Disease: Noonan Syndrome-like Disorder With Or Without Juvenile Myelomonocytic Leukemia

Research Articles on CBL

Similar Products

Product Notes

The CBL cbl (Catalog #AAA3202736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBL Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CBL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBL cbl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GEGNLAAAHA NTGPEESENE DDGYDVPKPP VPAVLARRTL SDISNASSSF. It is sometimes possible for the material contained within the vial of "CBL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.