Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Rabbit KCNH2 Polyclonal Antibody | anti-KCNH2 antibody

KCNH2 antibody - middle region

Gene Names
KCNH2; ERG1; HERG; LQT2; SQT1; ERG-1; H-ERG; HERG1; Kv11.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNH2; Polyclonal Antibody; KCNH2 antibody - middle region; anti-KCNH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPG
Sequence Length
819
Applicable Applications for anti-KCNH2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-KCNH2 antibody
This is a rabbit polyclonal antibody against KCNH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2).This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily H member 2 isoform c
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily H member 2
NCBI Official Symbol
KCNH2
NCBI Official Synonym Symbols
ERG1; HERG; LQT2; SQT1; ERG-1; H-ERG; HERG1; Kv11.1
NCBI Protein Information
potassium voltage-gated channel subfamily H member 2
UniProt Protein Name
Potassium voltage-gated channel subfamily H member 2
UniProt Gene Name
KCNH2
UniProt Synonym Gene Names
ERG; ERG1; HERG; ERG-1; Eag-related protein 1; Ether-a-go-go-related protein 1; H-ERG; hERG-1; hERG1
UniProt Entry Name
KCNH2_HUMAN

NCBI Description

This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Kv11.1: the ether-a-go-go related gene is a pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel is associated with cardiac arrhythmias and rhythmic excitability of the pituitary. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr). The potassium channel is probably composed of a homo- or heterotetrameric complex of pore-forming alpha subunits that can associate with modulating beta subunits. Heteromultimer with Kv11.2 and Kv11.3. Interacts with ALG10B. Heteromultimer with KCNE1 and KCNE2. Defects in Kv11.1 are the cause of long QT syndrome type 2 (LQT2), a heart disorder characterized by a prolonged QT interval on the ECG and polymorphic ventricular arrhythmias. They cause syncope and sudden death in response to exercise or emotional stress. Deafness is often associated with LQT2. Defects in Kv11.1 are the cause of short QT syndrome type 1 (SQT1), a heart disorder characterized by idiopathic persistently and uniformly short QT interval on ECG in the absence of structural heart disease in affected individuals. They cause syncope and sudden death. Four isoforms of the human protein are produced by alternative splicing. Isoform 3 has no channel activity by itself, but modulates channel characteristics when associated with isoform 1.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, potassium; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: voltage-gated potassium channel complex; cell surface; cytoplasm; plasma membrane; nuclear envelope

Molecular Function: identical protein binding; protein binding; voltage-gated potassium channel activity; protein homodimerization activity; delayed rectifier potassium channel activity; ubiquitin protein ligase binding; inward rectifier potassium channel activity; two-component sensor activity

Biological Process: synaptic transmission; regulation of membrane potential; two-component signal transduction system (phosphorelay); regulation of the rate of heart contraction by hormone; potassium ion homeostasis; cardiac muscle contraction

Disease: Long Qt Syndrome 2; Short Qt Syndrome 1

Research Articles on KCNH2

Similar Products

Product Notes

The KCNH2 kcnh2 (Catalog #AAA3202586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNH2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNH2 kcnh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQVSQFMACE ELPPGAPELP QEGPTRRLSL PGQLGALTSQ PLHRHGSDPG. It is sometimes possible for the material contained within the vial of "KCNH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.