Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KCNC4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Rabbit KCNC4 Polyclonal Antibody | anti-KCNC4 antibody

KCNC4 Antibody - N-terminal region

Gene Names
KCNC4; KV3.4; C1orf30; KSHIIIC; HKSHIIIC
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNC4; Polyclonal Antibody; KCNC4 Antibody - N-terminal region; anti-KCNC4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GAGPSDEAGDDERELALQRLGPHEGGAGHGAGSGGCRGWQPRMWALFEDP
Sequence Length
635
Applicable Applications for anti-KCNC4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Horse: 92%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNC4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KCNC4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KCNC4Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNC4 antibody
This is a rabbit polyclonal antibody against KCNC4. It was validated on Western Blot

Target Description: The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Multiple transcript variants have been found for this gene.
Product Categories/Family for anti-KCNC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily C member 4 isoform a
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily C member 4
NCBI Official Symbol
KCNC4
NCBI Official Synonym Symbols
KV3.4; C1orf30; KSHIIIC; HKSHIIIC
NCBI Protein Information
potassium voltage-gated channel subfamily C member 4
UniProt Protein Name
Potassium voltage-gated channel subfamily C member 4
UniProt Gene Name
KCNC4
UniProt Entry Name
KCNC4_HUMAN

NCBI Description

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Multiple transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

Kv3.4: This protein mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Belongs to the potassium channel family. C (Shaw) (TC 1.A.1.2) subfamily. Kv3.4/KCNC4 sub-subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Channel, potassium; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p21

Cellular Component: voltage-gated potassium channel complex; plasma membrane; integral to membrane; nerve terminal; neuromuscular junction

Molecular Function: voltage-gated potassium channel activity; potassium channel activity; delayed rectifier potassium channel activity

Biological Process: synaptic transmission; regulation of neurotransmitter secretion; protein homooligomerization; potassium ion transport

Research Articles on KCNC4

Similar Products

Product Notes

The KCNC4 kcnc4 (Catalog #AAA3202453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNC4 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNC4 kcnc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GAGPSDEAGD DERELALQRL GPHEGGAGHG AGSGGCRGWQ PRMWALFEDP. It is sometimes possible for the material contained within the vial of "KCNC4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.