Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung )

Rabbit BTBD14B Polyclonal Antibody | anti-NACC1 antibody

BTBD14B antibody - middle region

Gene Names
NACC1; NAC1; BEND8; NAC-1; NECFM; BTBD30; BTBD14B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
BTBD14B; Polyclonal Antibody; BTBD14B antibody - middle region; anti-NACC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDL
Sequence Length
527
Applicable Applications for anti-NACC1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BTBD14B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung )

Immunohistochemistry (IHC) (Human Lung )

Western Blot (WB)

(WB Suggested Anti-BTBD14B Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-BTBD14B Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-NACC1 antibody
This is a rabbit polyclonal antibody against BTBD14B. It was validated on Western Blot and immunohistochemistry

Target Description: The function of the Anti-BTBD14B gene has not yet been determined

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
nucleus accumbens-associated protein 1
NCBI Official Synonym Full Names
nucleus accumbens associated 1
NCBI Official Symbol
NACC1
NCBI Official Synonym Symbols
NAC1; BEND8; NAC-1; NECFM; BTBD30; BTBD14B
NCBI Protein Information
nucleus accumbens-associated protein 1
UniProt Protein Name
Nucleus accumbens-associated protein 1
UniProt Gene Name
NACC1
UniProt Synonym Gene Names
BTBD14B; NAC1; NAC-1
UniProt Entry Name
NACC1_HUMAN

NCBI Description

This gene encodes a member of the BTB/POZ protein family. BTB/POZ proteins are involved in several cellular processes including proliferation, apoptosis and transcription regulation. The encoded protein is a transcriptional repressor that plays a role in stem cell self-renewal and pluripotency maintenance. The encoded protein also suppresses transcription of the candidate tumor suppressor Gadd45GIP1, and expression of this gene may play a role in the progression of multiple types of cancer. A pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Feb 2012]

Research Articles on NACC1

Similar Products

Product Notes

The NACC1 nacc1 (Catalog #AAA3202173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BTBD14B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BTBD14B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NACC1 nacc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGMDEQYRQI CNMYTMYSMM NVGQTAEKVE ALPEQVAPES RNRIRVRQDL. It is sometimes possible for the material contained within the vial of "BTBD14B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.