Western Blot (WB)
(WB Suggested Anti-RNF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRNF2 is supported by BioGPS gene expression data to be expressed in Daudi)
Rabbit RNF2 Polyclonal Antibody | anti-RNF2 antibody
RNF2 antibody - middle region
Gene Names
RNF2; BAP1; DING; BAP-1; HIPI3; RING2; RING1B
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RNF2; Polyclonal Antibody; RNF2 antibody - middle region; anti-RNF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVF
Sequence Length
336
Applicable Applications for anti-RNF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RNF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RNF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRNF2 is supported by BioGPS gene expression data to be expressed in Daudi)
Western Blot (WB)
(WB Suggested Anti-RNF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Daudi cell lysateRNF2 is supported by BioGPS gene expression data to be expressed in Daudi)
Western Blot (WB)
(WB Suggested Anti-RNF2 antibody Titration: 1 ug/mLSample Type: Human Daudi)
Western Blot (WB)
(WB Suggested Anti-RNF2 antibody Titration: 1 ug/mLSample Type: Human Daudi)
Western Blot (WB)
(WB Suggested Anti-RNF2 antibody Titration: 1 ug/mLSample Type: Human Heart)
Western Blot (WB)
(WB Suggested Anti-RNF2 antibody Titration: 1 ug/mLSample Type: Human Heart)
Related Product Information for anti-RNF2 antibody
This is a rabbit polyclonal antibody against RNF2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by RNF2 is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.
Target Description: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by RNF2 is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.
Product Categories/Family for anti-RNF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RING2
NCBI Official Synonym Full Names
ring finger protein 2
NCBI Official Symbol
RNF2
NCBI Official Synonym Symbols
BAP1; DING; BAP-1; HIPI3; RING2; RING1B
NCBI Protein Information
E3 ubiquitin-protein ligase RING2
UniProt Protein Name
E3 ubiquitin-protein ligase RING2
Protein Family
UniProt Gene Name
RNF2
UniProt Synonym Gene Names
BAP1; DING; HIPI3; RING1B; HIP2-interacting protein 3; RING1b
UniProt Entry Name
RING2_HUMAN
NCBI Description
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq, Jul 2008]
Research Articles on RNF2
Similar Products
Product Notes
The RNF2 rnf2 (Catalog #AAA3201966) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RNF2 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RNF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RNF2 rnf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NASTHSNQEA GPSNKRTKTS DDSGLELDNN NAAMAIDPVM DGASEIELVF. It is sometimes possible for the material contained within the vial of "RNF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
