Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/mlPositive Control: Human Lung)

Rabbit TCFL1 Polyclonal Antibody | anti-VPS72 antibody

TCFL1 antibody - middle region

Gene Names
VPS72; YL1; CFL1; Swc2; YL-1; TCFL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCFL1; Polyclonal Antibody; TCFL1 antibody - middle region; anti-VPS72 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPK
Sequence Length
364
Applicable Applications for anti-VPS72 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCFL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-TCFL1 Antibody Titration: 0.06ug/mlPositive Control: Human Lung)
Related Product Information for anti-VPS72 antibody
This is a rabbit polyclonal antibody against TCFL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TCFL1 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein 72 homolog isoform 2
NCBI Official Synonym Full Names
vacuolar protein sorting 72 homolog
NCBI Official Symbol
VPS72
NCBI Official Synonym Symbols
YL1; CFL1; Swc2; YL-1; TCFL1
NCBI Protein Information
vacuolar protein sorting-associated protein 72 homolog
UniProt Protein Name
Vacuolar protein sorting-associated protein 72 homolog
UniProt Gene Name
VPS72
UniProt Synonym Gene Names
TCFL1; YL1
UniProt Entry Name
VPS72_HUMAN

NCBI Description

The protein encoded by this gene is a shared subunit of two multi-component complexes, the histone acetyltransferase complex TRRAP/TIP60 as well as the chromatin remodeling SRCAP-containing complex. The TRRAP/TIP60 complex acetylates nucleosomal histones important for transcriptional regulation, double strand DNA break repair and apoptosis. The SRCAP-containing complex catalyzes the exchange of histone H2A with the histone variant Htz1 (H2AFZ) into nucleosomes. This protein may be responsible for binding H2AFZ, which has a role in chromosome segregation. This protein may also have a role in regulating long-term hematopoietic stem cell activity. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Aug 2012]

Uniprot Description

VPS72: Could be a DNA-binding transcriptional regulator. May be involved in chromatin modification and remodeling. Belongs to the VPS72/YL1 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; protein complex; nucleus

Molecular Function: protein binding; DNA binding

Biological Process: establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; somatic stem cell maintenance; negative regulation of transcription from RNA polymerase II promoter; chromatin modification

Research Articles on VPS72

Similar Products

Product Notes

The VPS72 vps72 (Catalog #AAA3201847) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCFL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TCFL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VPS72 vps72 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEELNLRSLE TYERLEADKK KQVHKKRKCP GPIITYHSVT VPLVGEPGPK. It is sometimes possible for the material contained within the vial of "TCFL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.