Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (HepG2)

Rabbit TNKS Polyclonal Antibody | anti-TNKS antibody

TNKS antibody - middle region

Gene Names
TNKS; TIN1; ARTD5; PARPL; TINF1; TNKS1; pART5; PARP5A; PARP-5a
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TNKS; Polyclonal Antibody; TNKS antibody - middle region; anti-TNKS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST
Sequence Length
1327
Applicable Applications for anti-TNKS antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNKS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(HepG2)

Immunohistochemistry (IHC) (HepG2)

Western Blot (WB)

(Host: MouseTarget Name: TNKSSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TNKSSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TNKS Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateTNKS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-TNKS Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateTNKS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-TNKS antibody
This is a rabbit polyclonal antibody against TNKS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142kDa
NCBI Official Full Name
poly
NCBI Official Synonym Full Names
tankyrase
NCBI Official Symbol
TNKS
NCBI Official Synonym Symbols
TIN1; ARTD5; PARPL; TINF1; TNKS1; pART5; PARP5A; PARP-5a
NCBI Protein Information
poly [ADP-ribose] polymerase tankyrase-1; tankyrase-1
UniProt Protein Name
Tankyrase-1
Protein Family
UniProt Gene Name
TNKS
UniProt Synonym Gene Names
PARP5A; PARPL; TIN1; TINF1; TNKS1; TANK1; ARTD5
UniProt Entry Name
TNKS1_HUMAN

Uniprot Description

TNKS: Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation (PARsylation) of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates PARsylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates PARsylation of TERF1, thereby contributing to the regulation of telomere length. Involved in centrosome maturation during prometaphase by mediating PARsylation of HEPACAM2/MIKI. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. May be involved in spindle pole assembly through PARsylation of NUMA1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.4.2.30; Transferase

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: Golgi membrane; spindle pole; Golgi apparatus; pericentriolar material; chromosome, telomeric region; nuclear membrane; nuclear chromosome, telomeric region; nuclear pore; cytosol; chromosome, pericentric region

Molecular Function: protein binding; zinc ion binding; NAD+ ADP-ribosyltransferase activity

Biological Process: mitosis; protein polyubiquitination; mRNA transport; Wnt receptor signaling pathway; peptidyl-threonine phosphorylation; spindle assembly; negative regulation of DNA binding; positive regulation of telomere maintenance via telomerase; peptidyl-serine phosphorylation; protein amino acid ADP-ribosylation; protein transport; mitotic spindle organization and biogenesis; cell division; positive regulation of transcription from RNA polymerase II promoter; regulation of telomere maintenance via telomerase

Research Articles on TNKS

Similar Products

Product Notes

The TNKS tnks (Catalog #AAA3201705) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNKS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TNKS can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TNKS tnks for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIKGVERLLG GQQGTNPYLT FHCVNQGTIL LDLAPEDKEY QSVEEEMQST. It is sometimes possible for the material contained within the vial of "TNKS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.