Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SOX13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

Rabbit SOX13 Polyclonal Antibody | anti-SOX13 antibody

SOX13 antibody - middle region

Gene Names
SOX13; ICA12; Sox-13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOX13; Polyclonal Antibody; SOX13 antibody - middle region; anti-SOX13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Sequence Length
622
Applicable Applications for anti-SOX13 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 87%; Guinea Pig: 100%; Horse: 87%; Human: 100%; Mouse: 100%; Rabbit: 80%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SOX13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-SOX13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysate)
Related Product Information for anti-SOX13 antibody
This is a rabbit polyclonal antibody against SOX13. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SOX13 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
transcription factor SOX-13
NCBI Official Synonym Full Names
SRY-box 13
NCBI Official Symbol
SOX13
NCBI Official Synonym Symbols
ICA12; Sox-13
NCBI Protein Information
transcription factor SOX-13
UniProt Protein Name
Transcription factor SOX-13
Protein Family
UniProt Gene Name
SOX13
UniProt Entry Name
SOX13_HUMAN

NCBI Description

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12. [provided by RefSeq, Jul 2008]

Uniprot Description

SOX13: Binds to the sequence 5'-AACAAT-3'.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: anatomical structure morphogenesis; regulation of gamma-delta T cell differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Research Articles on SOX13

Similar Products

Product Notes

The SOX13 sox13 (Catalog #AAA3201685) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX13 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOX13 sox13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVIVNTCSLR EEGEGTDDRH SVADGEMYRY SEDEDSEGEE KSDGELVVLT. It is sometimes possible for the material contained within the vial of "SOX13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.