Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TRIM25Sample Type: Breast tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit TRIM25 Polyclonal Antibody | anti-TRIM25 antibody

TRIM25 Antibody - C-terminal region

Gene Names
TRIM25; EFP; Z147; RNF147; ZNF147
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIM25; Polyclonal Antibody; TRIM25 Antibody - C-terminal region; anti-TRIM25 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVA
Sequence Length
422
Applicable Applications for anti-TRIM25 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human TRIM25
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TRIM25Sample Type: Breast tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TRIM25Sample Type: Breast tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TRIM25 antibody
This is a rabbit polyclonal antibody against TRIM25. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presence of potential DNA-binding and dimerization-transactivation domains suggests that this protein may act as a transcription factor, similar to several other members of the TRIM family. Expression of the gene is upregulated in response to estrogen, and it is thought to mediate estrogen actions in breast cancer as a primary response gene.
Product Categories/Family for anti-TRIM25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
E3 ubiquitin/ISG15 ligase TRIM25
NCBI Official Synonym Full Names
tripartite motif containing 25
NCBI Official Symbol
TRIM25
NCBI Official Synonym Symbols
EFP; Z147; RNF147; ZNF147
NCBI Protein Information
E3 ubiquitin/ISG15 ligase TRIM25
UniProt Protein Name
E3 ubiquitin/ISG15 ligase TRIM25
Protein Family
UniProt Gene Name
TRIM25
UniProt Synonym Gene Names
EFP; RNF147; ZNF147
UniProt Entry Name
TRI25_HUMAN

NCBI Description

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to the cytoplasm. The presence of potential DNA-binding and dimerization-transactivation domains suggests that this protein may act as a transcription factor, similar to several other members of the TRIM family. Expression of the gene is upregulated in response to estrogen, and it is thought to mediate estrogen actions in breast cancer as a primary response gene. [provided by RefSeq, Jul 2008]

Uniprot Description

TRIM25: a ubiquitous protein that mediates estrogen action in various target organs. Contains one RING-type zinc finger and one SPRY domain.

Protein type: EC 6.3.2.n3; Ubiquitin conjugating system; Ubiquitin ligase; Nuclear receptor co-regulator; Transcription factor; Ligase; EC 6.3.2.19

Chromosomal Location of Human Ortholog: 17q23.2

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: protein binding; acid-amino acid ligase activity; zinc ion binding; transcription factor activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; negative regulation of virion penetration into host cell; cytokine and chemokine mediated signaling pathway; protein ubiquitination; regulation of virion penetration into host cell; activation of NF-kappaB transcription factor; response to vitamin D; response to estrogen stimulus; innate immune response; positive regulation of transcription factor activity; negative regulation of interferon type I production; defense response to virus

Research Articles on TRIM25

Similar Products

Product Notes

The TRIM25 trim25 (Catalog #AAA3201654) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIM25 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM25 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIM25 trim25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSASWCVEWF NTKISAWHNN VEKTLPSTKA TRVGVLLNCD HGFVIFFAVA. It is sometimes possible for the material contained within the vial of "TRIM25, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.