Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SOX12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit SOX12 Polyclonal Antibody | anti-SOX12 antibody

SOX12 antibody - C-terminal region

Gene Names
SOX12; SOX22
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOX12; Polyclonal Antibody; SOX12 antibody - C-terminal region; anti-SOX12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVFTY
Sequence Length
315
Applicable Applications for anti-SOX12 antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SOX12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-SOX12 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-SOX12 antibody
This is a rabbit polyclonal antibody against SOX12. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The SOX12 gene encodes a protein that was identified as a SOX family member based on conserved domains and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
transcription factor SOX-12
NCBI Official Synonym Full Names
SRY-box 12
NCBI Official Symbol
SOX12
NCBI Official Synonym Symbols
SOX22
NCBI Protein Information
transcription factor SOX-12
UniProt Protein Name
Transcription factor SOX-12
Protein Family
UniProt Gene Name
SOX12
UniProt Synonym Gene Names
SOX22
UniProt Entry Name
SOX12_HUMAN

NCBI Description

Members of the SOX family of transcription factors are characterized by the presence of a DNA-binding high mobility group (HMG) domain, homologous to the HMG box of sex-determining region Y (SRY). Forming a subgroup of the HMG domain superfamily, SOX proteins have been implicated in cell fate decisions in a diverse range of developmental processes. SOX transcription factors have diverse tissue-specific expression patterns during early development and have been proposed to act as target-specific transcription factors and/or as chromatin structure regulatory elements. The protein encoded by this gene was identified as a SOX family member based on conserved domains, and its expression in various tissues suggests a role in both differentiation and maintenance of several cell types. [provided by RefSeq, Jan 2013]

Uniprot Description

Function: Binds to the sequence 5'-AACAAT-3'

By similarity.

Subcellular location: Nucleus Ref.1.

Tissue specificity: Expressed most abundantly in the CNS. Also expressed in fetal brain and kidney and adult heart, pancreas, testis and ovary. Other tissues were only weakly positive. Ref.1

Sequence similarities: Contains 1 HMG box DNA-binding domain.

Sequence caution: The sequence AAB69627.1 differs from that shown. Reason: Frameshift at positions 135 and 201.

Research Articles on SOX12

Similar Products

Product Notes

The SOX12 sox12 (Catalog #AAA3201453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX12 antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOX12 sox12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DCSALDRDPD LQPPSGTSHF EFPDYCTPEV TEMIAGDWRP SSIADLVFTY. It is sometimes possible for the material contained within the vial of "SOX12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.