Western Blot (WB)
(WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)
Rabbit SOX11 Polyclonal Antibody | anti-SOX11 antibody
SOX11 antibody - middle region
Gene Names
SOX11; MRD27
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOX11; Polyclonal Antibody; SOX11 antibody - middle region; anti-SOX11 antibody
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAG
Sequence Length
441
Applicable Applications for anti-SOX11 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)
Western Blot (WB)
(WB Suggested Anti-SOX11 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)
Related Product Information for anti-SOX11 antibody
This is a rabbit polyclonal antibody against SOX11. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SOX11 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: SOX11 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-SOX11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
transcription factor SOX-11
NCBI Official Synonym Full Names
SRY-box 11
NCBI Official Symbol
SOX11
NCBI Official Synonym Symbols
MRD27
NCBI Protein Information
transcription factor SOX-11
UniProt Protein Name
Transcription factor SOX-11
Protein Family
UniProt Gene Name
SOX11
NCBI Description
This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may function in the developing nervous system and play a role in tumorigenesis. [provided by RefSeq, Jul 2008]
Uniprot Description
Transcriptional factor involved in the embryonic neurogenesis. May also have a role in tissue modeling during development.
Research Articles on SOX11
Similar Products
Product Notes
The SOX11 sox11 (Catalog #AAA3201451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX11 antibody - middle region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SOX11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOX11 sox11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHQQLLQPPG QQPSQLLRRY NVAKVPASPT LSSSAESPEG ASLYDEVRAG. It is sometimes possible for the material contained within the vial of "SOX11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
