Western Blot (WB)
(WB Suggested Anti-Tollip AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Rabbit Tollip Polyclonal Antibody | anti-TOLLIP antibody
Tollip antibody - N-terminal region
Gene Names
Tollip; 4930403G24Rik; 4931428G15Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tollip; Polyclonal Antibody; Tollip antibody - N-terminal region; anti-TOLLIP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGTVG
Sequence Length
274
Applicable Applications for anti-TOLLIP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Tollip AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Western Blot (WB)
(WB Suggested Anti-Tollip AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-TOLLIP antibody
This is a rabbit polyclonal antibody against Tollip. It was validated on Western Blot
Target Description: Tollip is a component of the signaling pathway of IL-1 and Toll-like receptors.Tollip inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Tollip inhibits IRAK1 phosphorylation and kinase activity.
Target Description: Tollip is a component of the signaling pathway of IL-1 and Toll-like receptors.Tollip inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Tollip inhibits IRAK1 phosphorylation and kinase activity.
Product Categories/Family for anti-TOLLIP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
toll-interacting protein isoform 1
NCBI Official Synonym Full Names
toll interacting protein
NCBI Official Symbol
Tollip
NCBI Official Synonym Symbols
4930403G24Rik; 4931428G15Rik
NCBI Protein Information
toll-interacting protein
UniProt Protein Name
Toll-interacting protein
Protein Family
UniProt Gene Name
Tollip
Uniprot Description
Component of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity. Connects the ubiquitin pathway to autophagy by functioning as a ubiquitin-ATG8 family adapter and thus mediating autophagic clearance of ubiquitin conjugates. The TOLLIP-dependent selective autophagy pathway plays an important role in clearance of cytotoxic polyQ proteins aggregates ().
Research Articles on TOLLIP
Similar Products
Product Notes
The TOLLIP tollip (Catalog #AAA3201409) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tollip antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tollip can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TOLLIP tollip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATTVSTQRG PVYIGELPQD FLRITPTQQQ QQIQLDAQAA QQLQYGGTVG. It is sometimes possible for the material contained within the vial of "Tollip, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
