Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIAS4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit PIAS4 Polyclonal Antibody | anti-PIAS4 antibody

PIAS4 antibody - N-terminal region

Gene Names
PIAS4; PIASY; Piasg; ZMIZ6; PIAS-gamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIAS4; Polyclonal Antibody; PIAS4 antibody - N-terminal region; anti-PIAS4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK
Sequence Length
510
Applicable Applications for anti-PIAS4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIAS4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIAS4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PIAS4 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PIAS4 antibody
This is a rabbit polyclonal antibody against PIAS4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PIAS4 is an inhibitor of TRIF-induced ISRE and NF-kappaB activation. Its mRNA is selectively expressed in endothelial cells, and its expression can be regulated by angiogenic growth factors

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
E3 SUMO-protein ligase PIAS4
NCBI Official Synonym Full Names
protein inhibitor of activated STAT 4
NCBI Official Symbol
PIAS4
NCBI Official Synonym Symbols
PIASY; Piasg; ZMIZ6; PIAS-gamma
NCBI Protein Information
E3 SUMO-protein ligase PIAS4
UniProt Protein Name
E3 SUMO-protein ligase PIAS4
Protein Family
UniProt Gene Name
PIAS4
UniProt Synonym Gene Names
PIASG; PIAS-gamma
UniProt Entry Name
PIAS4_HUMAN

Uniprot Description

PIAS4: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway, the Wnt pathway and the steroid hormone signaling pathway. Involved in gene silencing. Promotes PARK7 sumoylation. In Wnt signaling, represses LEF1 and enhances TCF4 transcriptional activities through promoting their sumoylations. Interacts with AR, AXIN1, GATA2, LEF1, TP53 and STAT1 (IFNG-induced). Binds to AT-rich DNA sequences, known as matrix or scaffold attachment regions (MARs/SARs). Interacts with TICAM1. Interacts with KLF8; the interaction results in SUMO ligation and repression of KLF8 transcriptional activity and of its cell cycle progression into G(1) phase. Highly expressed in testis and, at lower levels, in spleen, prostate, ovary, colon and peripheral blood leukocytes. Belongs to the PIAS family.

Protein type: EC 6.3.2.-; SUMO conjugating system; Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; PML body; nuclear matrix; cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; ubiquitin protein ligase binding; SUMO ligase activity; ligase activity

Biological Process: positive regulation of protein sumoylation; Wnt receptor signaling pathway; protein sumoylation; transcription, DNA-dependent; inhibition of NF-kappaB transcription factor; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent

Research Articles on PIAS4

Similar Products

Product Notes

The PIAS4 pias4 (Catalog #AAA3201283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIAS4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIAS4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIAS4 pias4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKNMVMSFRV SDLQMLLGFV GRSKSGLKHE LVTRALQLVQ FDCSPELFKK. It is sometimes possible for the material contained within the vial of "PIAS4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.