Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit TBX21 Polyclonal Antibody | anti-TBX21 antibody

TBX21 antibody - middle region

Gene Names
TBX21; TBET; T-PET; T-bet; TBLYM
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
TBX21; Polyclonal Antibody; TBX21 antibody - middle region; anti-TBX21 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
Sequence Length
535
Applicable Applications for anti-TBX21 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TBX21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Human Skeletal Muscle )

Immunohistochemistry (IHC) (Human Skeletal Muscle )

Western Blot (WB)

(WB Suggested Anti-TBX21 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-TBX21 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-TBX21 antibody
This is a rabbit polyclonal antibody against TBX21. It was validated on Western Blot and immunohistochemistry

Target Description: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
T-box transcription factor TBX21
NCBI Official Synonym Full Names
T-box 21
NCBI Official Symbol
TBX21
NCBI Official Synonym Symbols
TBET; T-PET; T-bet; TBLYM
NCBI Protein Information
T-box transcription factor TBX21
UniProt Protein Name
T-box transcription factor TBX21
UniProt Gene Name
TBX21
UniProt Synonym Gene Names
TBET; TBLYM; T-box protein 21
UniProt Entry Name
TBX21_HUMAN

NCBI Description

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells. [provided by RefSeq, Jul 2008]

Uniprot Description

TBX21: Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs. T-cell specific.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: cell soma; nucleus

Molecular Function: transcription factor activity

Biological Process: positive regulation of isotype switching to IgG isotypes; regulation of transcription, DNA-dependent; transcription, DNA-dependent; multicellular organismal development; response to virus; positive regulation of transcription, DNA-dependent; T cell differentiation

Disease: Asthma, Nasal Polyps, And Aspirin Intolerance

Research Articles on TBX21

Similar Products

Product Notes

The TBX21 tbx21 (Catalog #AAA3201048) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBX21 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBX21 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TBX21 tbx21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIPSPPGPNC QFLGGDHYSP LLPNQYPVPS RFYPDLPGQA KDVVPQAYWL. It is sometimes possible for the material contained within the vial of "TBX21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.