Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PITX2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Rabbit PITX2 Polyclonal Antibody | anti-PITX2 antibody

PITX2 antibody - N-terminal region

Gene Names
PITX2; RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; ASGD4; IGDS2; IRID2; Otlx2; RIEG1
Reactivity
Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PITX2; Polyclonal Antibody; PITX2 antibody - N-terminal region; anti-PITX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EFTDSPESRKEAASSKFFPRQHPGANEKDKSQQGKNEDVGAEDPSKKKRQ
Sequence Length
317
Applicable Applications for anti-PITX2 antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Mouse: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PITX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PITX2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PITX2Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:31250Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-PITX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:31250Positive Control: Human heart)
Related Product Information for anti-PITX2 antibody
This is a rabbit polyclonal antibody against PITX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The PITX2 gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. Mutations in PITX2 are associated with Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis syndrome (IGDS), and sporadic cases of Peters anomaly. This protein is involved in the development of the eye, tooth and abdominal organs. It also acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
pituitary homeobox 2 isoform b
NCBI Official Synonym Full Names
paired like homeodomain 2
NCBI Official Symbol
PITX2
NCBI Official Synonym Symbols
RS; RGS; ARP1; Brx1; IDG2; IGDS; IHG2; PTX2; RIEG; ASGD4; IGDS2; IRID2; Otlx2; RIEG1
NCBI Protein Information
pituitary homeobox 2
UniProt Protein Name
Pituitary homeobox 2
Protein Family
UniProt Gene Name
PITX2
UniProt Synonym Gene Names
ARP1; RGS; RIEG; RIEG1
UniProt Entry Name
PITX2_HUMAN

NCBI Description

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. The encoded protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. This protein plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this gene are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PITX2: Controls cell proliferation in a tissue-specific manner and is involved in morphogenesis. During embryonic development, exerts a role in the expansion of muscle progenitors. May play a role in the proper localization of asymmetric organs such as the heart and stomach. Isoform PTX2C is involved in left-right asymmetry the developing embryo. Defects in PITX2 are the cause of Axenfeld-Rieger syndrome type 1 (RIEG1); also known as Rieger syndrome type 1. RIEG1 is an autosomal dominant defect characterized by hypodontia (partial anodontia), anal stenosis, hypertelorism, mental deficiency, agenesis of the facial bones, with malformation of the anterior chamber of the eye. Defects in PITX2 are the cause of iridogoniodysgenesis type 2 (IRID2); also known as iridogoniodysgenesis syndrome 2 (IGDS2). It is an autosomal dominant inherited disease. Defects in PITX2 are a cause of Peters anomaly (PAN). It is a congenital defect of the anterior chamber of the eye. Defects in PITX2 are associated with ring dermoid of cornea (RDC). RDC is an autosomal dominantly inherited syndrome characterized by bilateral annular limbal dermoids with corneal and conjunctival extension. Belongs to the paired homeobox family. Bicoid subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Cell cycle regulation; Motility/polarity/chemotaxis; DNA-binding

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; nucleus

Molecular Function: ribonucleoprotein binding; identical protein binding; protein binding; protein homodimerization activity; chromatin DNA binding; phosphoprotein binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; prolactin secreting cell differentiation; atrial cardiac muscle morphogenesis; ventricular cardiac muscle cell development; neuron migration; response to hormone stimulus; negative regulation of transcription from RNA polymerase II promoter; embryonic hindlimb morphogenesis; regulation of cell migration; somatotropin secreting cell differentiation; response to vitamin A; odontogenesis; regulation of transcription, DNA-dependent; embryonic digestive tract morphogenesis; vasculogenesis; extraocular skeletal muscle development; myoblast fusion; female gonad development; hypothalamus cell migration; positive regulation of DNA binding; spleen development; Wnt receptor signaling pathway; camera-type eye development; in utero embryonic development; male gonad development; hair cell differentiation; embryonic camera-type eye development; odontogenesis of dentine-containing teeth; regulation of transcription from RNA polymerase II promoter; patterning of blood vessels; subthalamic nucleus development; positive regulation of transcription from RNA polymerase II promoter; determination of left/right symmetry

Disease: Axenfeld-rieger Syndrome, Type 1; Peters Anomaly; Ring Dermoid Of Cornea; Iridogoniodysgenesis, Type 2

Research Articles on PITX2

Similar Products

Product Notes

The PITX2 pitx2 (Catalog #AAA3200935) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PITX2 antibody - N-terminal region reacts with Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PITX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PITX2 pitx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFTDSPESRK EAASSKFFPR QHPGANEKDK SQQGKNEDVG AEDPSKKKRQ. It is sometimes possible for the material contained within the vial of "PITX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.