Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SIRT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Rabbit SIRT1 Polyclonal Antibody | anti-SIRT1 antibody

SIRT1 antibody - N-terminal region

Gene Names
SIRT1; SIR2; SIR2L1; SIR2alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
SIRT1; Polyclonal Antibody; SIRT1 antibody - N-terminal region; anti-SIRT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
Sequence Length
747
Applicable Applications for anti-SIRT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SIRT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SIRT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SIRT1 Antibody Titration: 0.5ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-SIRT1 Antibody Titration: 0.5ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)
Related Product Information for anti-SIRT1 antibody
This is a rabbit polyclonal antibody against SIRT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
NAD-dependent protein deacetylase sirtuin-1 isoform a
NCBI Official Synonym Full Names
sirtuin 1
NCBI Official Symbol
SIRT1
NCBI Official Synonym Symbols
SIR2; SIR2L1; SIR2alpha
NCBI Protein Information
NAD-dependent protein deacetylase sirtuin-1
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-1
UniProt Gene Name
SIRT1
UniProt Synonym Gene Names
SIR2L1; hSIRT1; hSIR2; 75SirT1
UniProt Entry Name
SIR1_HUMAN

NCBI Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2008]

Uniprot Description

SIRT1: an NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separate cellular functions such as cell cycle, response to DNA damage, metobolism, apoptosis and autophagy. Deacetylates a broad range of transcription factors and coregulators, thereby regulating target gene expression positively and negatively. Serves as a sensor of the cytosolic ratio of NAD(+)/NADH which is altered by glucose deprivation and metabolic changes associated with caloric restriction. Essential in skeletal muscle cell differentiation and in response to low nutrients mediates the inhibitory effect on skeletal myoblast differentiation which also involves 5'-AMP-activated protein kinase (AMPK) and nicotinamide phosphoribosyltransferase (NAMPT). Component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. Elevation of NAD(+)/NADP(+) ratio activates SIRT1. Recruited to LRH1 target gene promoters by NR0B2/SHP thereby stimulating histone H3 and H4 deacetylation leading to transcriptional repression. Implicated in regulation of adipogenesis and fat mobilization in white adipocytes by repression of PPARG. Involved in liver and muscle metabolism. Is involved in autophagy, presumably by deacetylating ATG5, ATG7 and ATG8. Deacetylates AKT1 which leads to enhanced binding of AKT1 and PDK1 to PIP3 and promotes their activation. Widely expressed. Inhibited by nicotinamide. Belongs to the sirtuin family. Class I subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Deacetylase; Apoptosis; EC 3.5.1.-; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 10q21.3

Cellular Component: nucleoplasm; chromatin silencing complex; PML body; mitochondrion; ESC/E(Z) complex; nuclear chromatin; cytoplasm; nucleolus; nuclear inner membrane; nuclear envelope; nuclear heterochromatin; nucleus

Molecular Function: deacetylase activity; protein C-terminus binding; identical protein binding; histone binding; p53 binding; metal ion binding; protein deacetylase activity; transcription factor binding; protein binding; NAD-dependent histone deacetylase activity (H3-K9 specific); enzyme binding; NAD-dependent histone deacetylase activity; bHLH transcription factor binding; mitogen-activated protein kinase binding; histone deacetylase activity; transcription corepressor activity; HLH domain binding; NAD+ ADP-ribosyltransferase activity

Biological Process: establishment and/or maintenance of chromatin architecture; muscle development; viral reproduction; positive regulation of apoptosis; regulation of mitotic cell cycle; positive regulation of caspase activity; protein ubiquitination; negative regulation of prostaglandin biosynthetic process; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of gene expression, epigenetic; behavioral response to starvation; positive regulation of adaptive immune response; positive regulation of histone H3-K9 methylation; positive regulation of DNA repair; transcription, DNA-dependent; negative regulation of transcription factor activity; pyrimidine dimer repair via nucleotide-excision repair; cell aging; negative regulation of I-kappaB kinase/NF-kappaB cascade; ovulation from ovarian follicle; cellular response to starvation; negative regulation of fat cell differentiation; regulation of endodeoxyribonuclease activity; cholesterol homeostasis; protein amino acid ADP-ribosylation; methylation-dependent chromatin silencing; inhibition of NF-kappaB transcription factor; maintenance of chromatin silencing; regulation of protein import into nucleus, translocation; negative regulation of phosphorylation; positive regulation of transcription from RNA polymerase II promoter; response to oxidative stress; triacylglycerol mobilization; negative regulation of transcription, DNA-dependent; rRNA processing; peptidyl-lysine acetylation; negative regulation of apoptosis; chromatin silencing at rDNA; proteasomal ubiquitin-dependent protein catabolic process; establishment of chromatin silencing; chromatin silencing; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic; response to insulin stimulus; DNA synthesis during DNA repair; protein amino acid deacetylation; positive regulation of MHC class II biosynthetic process; positive regulation of cell proliferation; angiogenesis; circadian regulation of gene expression; DNA replication; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; positive regulation of chromatin silencing; single strand break repair; negative regulation of TOR signaling pathway; negative regulation of protein kinase B signaling cascade; protein destabilization; histone deacetylation; DNA repair; regulation of cell proliferation; negative regulation of helicase activity; response to hydrogen peroxide; fatty acid homeostasis; white fat cell differentiation; cell glucose homeostasis; spermatogenesis; gene expression; positive regulation of protein amino acid phosphorylation; positive regulation of insulin receptor signaling pathway; negative regulation of cell growth; negative regulation of transforming growth factor beta receptor signaling pathway; response to DNA damage stimulus; positive regulation of macroautophagy

Research Articles on SIRT1

Similar Products

Product Notes

The SIRT1 sirt1 (Catalog #AAA3200905) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIRT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SIRT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIRT1 sirt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PETIPPPELD DMTLWQIVIN ILSEPPKRKK RKDINTIEDA VKLLQECKKI. It is sometimes possible for the material contained within the vial of "SIRT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.