Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PRMT3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit PRMT3 Polyclonal Antibody | anti-PRMT3 antibody

PRMT3 antibody - middle region

Gene Names
PRMT3; HRMT1L3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRMT3; Polyclonal Antibody; PRMT3 antibody - middle region; anti-PRMT3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS
Sequence Length
531
Applicable Applications for anti-PRMT3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PRMT3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PRMT3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PRMT3 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PRMT3 antibody
This is a rabbit polyclonal antibody against PRMT3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PRMT3 is a ribosomal protein methyltransferase that affects the cellular level of ribosomal subunits
Product Categories/Family for anti-PRMT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
protein arginine N-methyltransferase 3 isoform 1
NCBI Official Synonym Full Names
protein arginine methyltransferase 3
NCBI Official Symbol
PRMT3
NCBI Official Synonym Symbols
HRMT1L3
NCBI Protein Information
protein arginine N-methyltransferase 3
UniProt Protein Name
Protein arginine N-methyltransferase 3
UniProt Gene Name
PRMT3
UniProt Synonym Gene Names
HRMT1L3
UniProt Entry Name
ANM3_HUMAN

NCBI Description

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

PRMT3: Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins. Belongs to the protein arginine N-methyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein; EC 2.1.1.-; Methyltransferase; Methyltransferase, protein arginine

Chromosomal Location of Human Ortholog: 11p15.1

Cellular Component: cytosol

Molecular Function: histone-arginine N-methyltransferase activity; methyltransferase activity; protein binding; protein-arginine omega-N asymmetric methyltransferase activity

Biological Process: negative regulation of protein ubiquitination; regulation of transcription, DNA-dependent

Research Articles on PRMT3

Similar Products

Product Notes

The PRMT3 prmt3 (Catalog #AAA3200769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRMT3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRMT3 prmt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSSYGHYGIH EEMLKDKIRT ESYRDFIYQN PHIFKDKVVL DVGCGTGILS. It is sometimes possible for the material contained within the vial of "PRMT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.