Western Blot (WB)
(WB Suggested Anti-SOX21 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Rabbit SOX21 Polyclonal Antibody | anti-SOX21 antibody
SOX21 antibody - middle region
Gene Names
SOX21; SOX25
Reactivity
Cow, Human, Mouse, Pig, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOX21; Polyclonal Antibody; SOX21 antibody - middle region; anti-SOX21 antibody
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAG
Sequence Length
276
Applicable Applications for anti-SOX21 antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SOX21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-SOX21 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-SOX21 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-SOX21 antibody
This is a rabbit polyclonal antibody against SOX21. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are d
Target Description: SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are d
Product Categories/Family for anti-SOX21 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
transcription factor SOX-21
NCBI Official Synonym Full Names
SRY-box 21
NCBI Official Symbol
SOX21
NCBI Official Synonym Symbols
SOX25
NCBI Protein Information
transcription factor SOX-21
UniProt Protein Name
Transcription factor SOX-21
Protein Family
UniProt Gene Name
SOX21
UniProt Synonym Gene Names
SOX25; SOXA
NCBI Description
SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are divided into 6 subgroups based on sequence similarity within and outside of the HMG domain. For additional background information on SOX genes, see SOX1 (MIM 602148).[supplied by OMIM, Apr 2004]
Uniprot Description
May play a role as an activator of transcription of OPRM1.
Research Articles on SOX21
Similar Products
Product Notes
The SOX21 sox21 (Catalog #AAA3200474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOX21 antibody - middle region reacts with Cow, Human, Mouse, Pig, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SOX21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOX21 sox21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHPDYKYRPR RKPKTLLKKD KFAFPVPYGL GGVADAEHPA LKAGAGLHAG. It is sometimes possible for the material contained within the vial of "SOX21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
