Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HMG20A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateHMG20A is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit HMG20A Polyclonal Antibody | anti-HMG20A antibody

HMG20A antibody - N-terminal region

Gene Names
HMG20A; HMGX1; HMGXB1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HMG20A; Polyclonal Antibody; HMG20A antibody - N-terminal region; anti-HMG20A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPE
Sequence Length
347
Applicable Applications for anti-HMG20A antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 82%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HMG20A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HMG20A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateHMG20A is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-HMG20A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateHMG20A is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-HMG20A antibody
This is a rabbit polyclonal antibody against HMG20A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HMG20A plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also act as inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
high mobility group protein 20A isoform a
NCBI Official Synonym Full Names
high mobility group 20A
NCBI Official Symbol
HMG20A
NCBI Official Synonym Symbols
HMGX1; HMGXB1
NCBI Protein Information
high mobility group protein 20A
UniProt Protein Name
High mobility group protein 20A
UniProt Gene Name
HMG20A
UniProt Synonym Gene Names
HMGX1; HMGXB1
UniProt Entry Name
HM20A_HUMAN

Uniprot Description

HMG20A: Plays a role in neuronal differentiation as chromatin- associated protein. Acts as inhibitor of HMG20B. Overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. Involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 15q24

Cellular Component: nucleus

Molecular Function: protein binding; DNA binding; protein heterodimerization activity; chromatin binding; transcription factor activity

Biological Process: chromatin remodeling; establishment and/or maintenance of chromatin architecture; negative regulation of neuron differentiation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter

Research Articles on HMG20A

Similar Products

Product Notes

The HMG20A hmg20a (Catalog #AAA3200455) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMG20A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMG20A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMG20A hmg20a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MENLMTSSTL PPLFADEDGS KESNDLATTG LNHPEVPYSS GATSSTNNPE. It is sometimes possible for the material contained within the vial of "HMG20A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.