Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-CREB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit CREB1 Polyclonal Antibody | anti-CREB1 antibody

CREB1 antibody - N-terminal region

Gene Names
CREB1; CREB; CREB-1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
CREB1; Polyclonal Antibody; CREB1 antibody - N-terminal region; anti-CREB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQES
Sequence Length
341
Applicable Applications for anti-CREB1 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 87%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CREB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CREB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-CREB1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-CREB1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateCREB1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-CREB1 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateCREB1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-CREB1 antibody
This is a rabbit polyclonal antibody against CREB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CREB1 is a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway.This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
cyclic AMP-responsive element-binding protein 1 isoform B
NCBI Official Synonym Full Names
cAMP responsive element binding protein 1
NCBI Official Symbol
CREB1
NCBI Official Synonym Symbols
CREB; CREB-1
NCBI Protein Information
cyclic AMP-responsive element-binding protein 1
UniProt Protein Name
Cyclic AMP-responsive element-binding protein 1
UniProt Gene Name
CREB1
UniProt Synonym Gene Names
CREB-1
UniProt Entry Name
CREB1_HUMAN

NCBI Description

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]

Uniprot Description

CREB: a transcription factor of the leucine zipper family of DNA binding proteins. Binds as a homodimer to the cAMP-responsive element (CRE). Phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Two splice-variant isoforms have been described.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 2q34

Cellular Component: nucleoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; enzyme binding; transcription cofactor activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; circadian rhythm; lactation; axon guidance; response to glucagon stimulus; viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of osteoclast differentiation; positive regulation of transcription, DNA-dependent; stress-activated MAPK cascade; positive regulation of multicellular organism growth; toll-like receptor 3 signaling pathway; signal transduction; protein amino acid phosphorylation; toll-like receptor 10 signaling pathway; response to organic substance; toll-like receptor 5 signaling pathway; synaptic transmission; toll-like receptor 4 signaling pathway; response to drug; epidermal growth factor receptor signaling pathway; mitochondrion organization and biogenesis; Notch signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; protein stabilization; secretory granule organization and biogenesis; MyD88-independent toll-like receptor signaling pathway; organelle organization and biogenesis; positive regulation of hormone secretion; positive regulation of lipid biosynthetic process; memory; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; phospholipase C activation; pituitary gland development; toll-like receptor signaling pathway; positive regulation of fat cell differentiation; innate immune response; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; regulation of cell size

Disease: Histiocytoma, Angiomatoid Fibrous

Research Articles on CREB1

Similar Products

Product Notes

The CREB1 creb1 (Catalog #AAA3200377) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CREB1 antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CREB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CREB1 creb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVHGVIQAAQ PSVIQSPQVQ TVQSSCKDLK RLFSGTQIST IAESEDSQES. It is sometimes possible for the material contained within the vial of "CREB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.