Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human Colon, myenteric plexusAnti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit HSP90AA1 Polyclonal Antibody | anti-HSP90AA1 antibody

HSP90AA1 antibody - N-terminal region

Gene Names
HSP90AA1; EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; LAP-2; HSP89A; HSP90A; HSP90N; Hsp103; HSPCAL1; HSPCAL4; HEL-S-65p
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
HSP90AA1; Polyclonal Antibody; HSP90AA1 antibody - N-terminal region; anti-HSP90AA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN
Sequence Length
854
Applicable Applications for anti-HSP90AA1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human Colon, myenteric plexusAnti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human Colon, myenteric plexusAnti-HSP90AA1 / Hsp90 antibody IHC staining of human colon, myenteric plexus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-HSP90AA1 antibody
This is a rabbit polyclonal antibody against HSP90AA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HSP90 proteins are highly conserved molecular chaperones that have key roles in signal transduction, protein folding, protein degradation, and morphologic evolution. HSP90 proteins normally associate with other cochaperones and play important roles in folding newly synthesized proteins or stabilizing and refolding denatured proteins after stress. There are 2 major cytosolic HSP90 proteins, HSP90AA1, an inducible form, and HSP90AB1 (MIM 140572), a constitutive form. Other HSP90 proteins are found in endoplasmic reticulum (HSP90B1; MIM 191175) and mitochondria (TRAP1; MIM 606219).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
heat shock protein HSP 90-alpha isoform 1
NCBI Official Synonym Full Names
heat shock protein 90 alpha family class A member 1
NCBI Official Symbol
HSP90AA1
NCBI Official Synonym Symbols
EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; LAP-2; HSP89A; HSP90A; HSP90N; Hsp103; HSPCAL1; HSPCAL4; HEL-S-65p
NCBI Protein Information
heat shock protein HSP 90-alpha
UniProt Protein Name
Heat shock protein HSP 90-alpha
Protein Family
UniProt Gene Name
HSP90AA1
UniProt Synonym Gene Names
HSP90A; HSPC1; HSPCA; HSP 86; HSP86
UniProt Entry Name
HS90A_HUMAN

NCBI Description

The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

HSP90A: a molecular chaperone of the heat shock protein 90 family. Has ATPase activity. Known to interact with a wide variety of proteins including steroid hormone receptors, neuropeptide Y, FKBP51/54, and FKBP52. G protein-coupled receptor kinases are stabilized by interacting with HSP 90. Hsp70 and Hsp90 promote tau solubility and tau binding to microtubules, reducing insoluble tau phosphorylation of tau.

Protein type: Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: nucleoplasm; membrane; mitochondrion; cytoplasm; extracellular region; plasma membrane; melanosome; nucleus; cytosol

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; TPR domain binding; ATPase activity; nitric-oxide synthase regulator activity; unfolded protein binding; nucleotide binding; ATP binding

Biological Process: axon guidance; receptor-mediated endocytosis; positive regulation of nitric oxide biosynthetic process; organelle organization and biogenesis; signal transduction; nitric oxide metabolic process; protein import into mitochondrial outer membrane; response to unfolded protein; mitochondrial transport; innate immune response; protein refolding; mitotic cell cycle; regulation of nitric-oxide synthase activity; vascular endothelial growth factor receptor signaling pathway; G2/M transition of mitotic cell cycle; chaperone-mediated protein complex assembly

Research Articles on HSP90AA1

Similar Products

Product Notes

The HSP90AA1 hsp90aa1 (Catalog #AAA3200189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSP90AA1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's HSP90AA1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HSP90AA1 hsp90aa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLYKDLQPFI LLRLLMPEET QTQDQPMEEE EVETFAFQAE IAQLMSLIIN. It is sometimes possible for the material contained within the vial of "HSP90AA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.