CD362 recombinant protein

CD362 Recombinant Protein

Cat. Num. AAA3004378

• Gene Names: SDC2; HSPG; CD362; HSPG1; SYND2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD362; CD362 Recombinant Protein; CD362 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 390
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD362 recombinant protein

Background: Syndecans are type I integral membrane proteoglycans that contain both chondroitin sulfate and heparan sulfate groups. Syndecans are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 (SYND1, also called CD138) is anextracellular matrix receptor which binds to collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 (also designated N-Syndecan) interact with MK (midkine), a growth/differentiation factor invloved in embryogenesis of the central nervous system. Syndecan-2 (also designated fibroglycan or HSPG) is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations.Syndecan-4 (also designated amphiglycan or ryudocan) functions cooperativleywith integrins in the processes of cell spreading, focal adhesion assembly andActin stress fiber assembly

NCBI and Uniprot Product Information

• NCBI GI #: 158962336
• NCBI GeneID: 6383
• UniProt Accession #: P34741; Q6PIS6; Q9H6V1; B3KQA3
• Molecular Weight: 201
• NCBI Official Full Name: Syndecan-2
• NCBI Official Synonym Full Names: syndecan 2
• NCBI Official Symbol: SDC2
• NCBI Official Synonym Symbols: HSPG; CD362; HSPG1; SYND2
• NCBI Protein Information: syndecan-2; fibroglycan; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated
• UniProt Protein Name: Syndecan-2
• UniProt Gene Name: SDC2
• UniProt Synonym Gene Names: HSPG1; SYND2; HSPG
• UniProt Entry Name: SDC2_HUMAN

NCBI Description

The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. The syndecan-2 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered syndecan-2 expression has been detected in several different tumor types. [provided by RefSeq, Jul 2008]

Uniprot Description

syndecan-2: a heparan sulfate proteoglycan type I membrane protein that belongs to the syndecan proteoglycan family. Preferentially expressed in cells of mesenchymal origin. Is tyrosine phosphorylated and forms a complex with EphB2 in mouse brain. Plays a role in mediating adhesion and proliferation of colon carcinoma cells.

Protein type: Cell adhesion; Cell surface; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8q22-q23

Cellular Component: lysosomal lumen; cell soma; Golgi lumen; integral to membrane; plasma membrane; synapse

Molecular Function: protein binding; PDZ domain binding

Biological Process: axon guidance; phototransduction, visible light; extracellular matrix organization and biogenesis; wound healing; glycosaminoglycan metabolic process; dendrite morphogenesis; regulation of dendrite morphogenesis; pathogenesis; response to caffeine; chondroitin sulfate metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan catabolic process; carbohydrate metabolic process; ephrin receptor signaling pathway; response to hypoxia; retinoid metabolic process